CAZyme Information: MGYG000003372_02239

Basic Information

• Species: Citrobacter werkmanii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter; Citrobacter werkmanii
• CAZyme ID: MGYG000003372_02239
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347	MGYG000003372_37|CGC4	39411.33	7.9194

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003372	4983851	MAG	United States	North America

• Gene Location: Start: 171269; End: 172312 Strand: +

Full Sequence      

MNVFISICIPSYNRAEFLEPLLDSIYNQDYATNNTDFEVIICEDKSPQRDEIKSIIEKYK
IKNNKANLNINLNKDNLGYDRNLKNCISSATGKYCMIMGNDDLLADGALSKIVTVLKANP
DIVLATRAYGWFKENPNELCDTVRHLTEDTLFQPGIDAIKFFFRRVGVISGFIVNAEKAN
RLSCDIFDGRLYYQMYLAGMLMAEGQGYYFSDVITLSRDTEAPDFGNAGTEKGIFTPGGY
KPEGRIHMVEGLLLIAKHIENTTKINGVYAGIKRDLANYFYPYIRDQLDLPLTTYLKMIN
DFRKIGFANEKLFYIHAILGYVLKRKGYDALIKYIRSKNGGTPRLGI

Enzyme Prediction     

No EC number prediction in MGYG000003372_02239.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	6	143	8.6e-22	0.7705882352941177

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	3.09e-18	7	132	1	118	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	9.23e-17	6	129	1	117	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04184	GT2_RfbC_Mx_like	3.94e-14	5	122	3	114	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
COG0463	WcaA	2.81e-13	1	127	1	115	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd04196	GT_2_like_d	2.00e-11	6	124	1	112	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWU66740.1	1.56e-257	1	347	1	347
QNQ23644.1	1.62e-234	1	347	1	347
QBA39614.1	1.62e-234	1	347	1	347
AYA12476.1	1.62e-234	1	347	1	347
BCT14994.1	2.31e-234	1	347	1	347

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26401	8.89e-14	3	127	1	120	Abequosyltransferase RfbV OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbV PE=1 SV=2
Q0P9C6	8.68e-07	5	119	4	109	GalNAc(5)-diNAcBac-PP-undecaprenol beta-1,3-glucosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003372_02239.