CAZyme Information: MGYG000003374_01757

Basic Information

• Species: Prevotella bivia
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella bivia
• CAZyme ID: MGYG000003374_01757
• CAZy Family: CBM9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000003374_69|CGC1	42572.23	6.6986

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003374	2286602	MAG	United States	North America

• Gene Location: Start: 1836; End: 2939 Strand: +

Full Sequence      

MKKSLLYIAFLAFPLALLAQKQGLRQKYKAFLTPPKRYVCYRTSEKITIDGKGDEQSWQL
AKSTENFEDISGEGHPKPYYPTNAKMLWDNDYLYVLGNITDPDLAAQLQQRDTIVYHDND
FEIFIDPTGDGHNYFEIEVNQLGTIFDLSLEKPYRSPSRGFIQFQWNCPGLQCAIHLDGT
LNNPNDRDKGWTVEMAIPRKAIAAEFDNYLKAGKVLRIGFSRVEWHRDYDVKTGLYLKRK
DTKGKTLPEDNWTWGATGMVAMHMPERWGYVYLSSVVVGEGTDTVKLPYDENMYRFMWMI
FYAQEEYFAKNHHYAKNYAALGLTITDRELAAGYKFTLETTTYTYELSAQRDGVSYVINQ
DGKFFKR

Enzyme Prediction     

No EC number prediction in MGYG000003374_01757.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM9	49	239	8.3e-42	0.8956043956043956

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09620	CBM9_like_3	7.41e-71	49	270	1	200	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily may co-occur with various other domains.
cd09618	CBM9_like_2	2.18e-20	37	223	1	170	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized subfamily are typically found at the N-terminus of longer proteins that lack additional annotation with domain footprints.
pfam06452	CBM9_1	1.76e-15	49	273	1	181	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.
cd09619	CBM9_like_4	3.52e-12	46	269	1	187	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	4.53e-07	84	221	22	141	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUI46257.1	4.33e-112	3	365	12	354
QCQ41457.1	4.44e-112	1	365	11	355
CBW22417.1	6.26e-112	1	365	11	355
QCQ32632.1	8.60e-112	22	365	27	354
QTO24490.1	1.21e-111	22	365	27	354

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000506	0.998811	0.000183	0.000163	0.000155	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003374_01757.