CAZyme Information: MGYG000003377_02354

Basic Information

• Species: Phytobacter sp002377245
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Phytobacter; Phytobacter sp002377245
• CAZyme ID: MGYG000003377_02354
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1217		136780.06	5.6282

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003377	5122475	MAG	United States	North America

• Gene Location: Start: 1540; End: 5193 Strand: +

Full Sequence      

MRSILISVDKLDVYSAQTSEALEVTDALLAAGWQIDIMTSAAGKVLTHEIEQRAATGRFN
VITESRGHLAARYDAIWIYRGYFHDLLLDALTEQRLAGAMIFRHFSDYNDLYIPYGVQLE
NQLASLTLGQSTRSNNILLQTGIESAQLQTLPWTVAEKFAAYERTRTTQGLQKILYVAPK
MTAEMYEIQLKAGEEGIQLDWLDLSSQRTGIEPAWLEQYDVVIGNEDSVPKALSLGIPLF
LANEGYVEGYLNEDNIERHENEHFCALTLRNCPDAEEWLELLKNGYPSALKWVTAHRSDF
IKKWHLGSMLDAIFSKPLAEKPLYINEKARYALSFHSKAVIAQQSTDYSMSRWLDDRQLS
AARREALLSFARSYPEKGSIGVIVVDPQADGAAREKTLASVHSQSLPPVSVDIISGQASP
ASAINTLLAERSADAMLIIPAGFTLLDDALLRFCEQRLHQQNAWLFYCDEMTREENGEPQ
LAIRPDVNIDLLRGIPYVGEVLLFSRDMALQLGGLNARYSHAPLIDLLWRFVEAQGAGAL
GRVADVLVESPYLPSQWSSSADVQQEGQDILLSHLSRLGIRATLEEGMAPGVARVRYHWD
ATPLVSIIIPTRDRFALLKRCVESLMEKTRYTRYELLIVDNQSVEEDACRFLNDLADSGI
EQVRVLRYDAPFNFAEINNAASQQARGEVLLFLNNDCEIIDGDWLGAMVEQVLRPEVGVV
GARLEYSDGRIQHGGYLVGVGLGAEVAFDGADSNSNGYQYFLKTPRNLAAVSASCMMVRK
DVFFALNGLNQEALPLYLADVDFGLRAQKSGYLNVWTPYARVKHMGGATRLMGQQFKVQE
RPLREDYATLRREWKEGVLAEPAYHPLMQKTGTPFTLSEHTARFRQPLPGRPLPVVLAHH
VNWQGNGHHRVMQPFKALERHLHMEGALISAIPGLMETAQLQPDVVLLELVTGSRFPEII
TQLREVNNAKIVLEYDDNLLNIPLKNGTRQHFPQKALKTFRKVIDSADWLVVSTEPLAEA
YSRFHSDIRVALNRLAPDQWGHLQSQRGVGEKIRIGWAGGSSHSGDLEILLPLIKALEGK
VEWVFMGMKPRNVRCEFHPGVPFDMYPEKLASLNLDLALVPLEANHFNECKSNLRLLEIG
TCGVPIIATNLAPYRCGLPVTLVENRFKDWMNAIQAFINDPLLRERQGDALREAVHRDWY
LRDAGLDDWREAWLPSR

Enzyme Prediction     

No EC number prediction in MGYG000003377_02354.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	606	783	4.1e-22	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	8.34e-38	607	826	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	6.51e-22	602	829	2	224	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	1.63e-18	606	783	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd03794	GT4_WbuB-like	2.23e-17	920	1199	77	381	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
cd00761	Glyco_tranf_GTA_type	1.66e-14	607	722	1	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMO48374.1	0.0	1	1216	1	1214
QEM91071.1	0.0	1	1216	1	1214
QOV62377.1	0.0	1	1216	1	1214
AGN84656.1	0.0	1	1216	1	1214
QHM94393.1	0.0	1	1216	1	1214

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PXU_A	5.90e-07	532	728	32	223	Crystalstructure of human GalNAc-T12 bound to a diglycosylated peptide, Mn2+, and UDP [Homo sapiens],6PXU_B Crystal structure of human GalNAc-T12 bound to a diglycosylated peptide, Mn2+, and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.17e-67	445	878	460	898	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	2.11e-53	415	880	384	843	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q8BGT9	4.92e-07	532	728	65	256	Polypeptide N-acetylgalactosaminyltransferase 12 OS=Mus musculus OX=10090 GN=Galnt12 PE=2 SV=1
Q8IXK2	3.37e-06	532	728	70	261	Polypeptide N-acetylgalactosaminyltransferase 12 OS=Homo sapiens OX=9606 GN=GALNT12 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003377_02354.