CAZyme Information: MGYG000003377_03830

Basic Information

• Species: Phytobacter sp002377245
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Phytobacter; Phytobacter sp002377245
• CAZyme ID: MGYG000003377_03830
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1201	MGYG000003377_91|CGC7	136239.7	5.8449

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003377	5122475	MAG	United States	North America

• Gene Location: Start: 169623; End: 173228 Strand: +

Full Sequence      

MKSLIELYNEHHGKSSDKWQIYLNTYHQVLSAERENVQNFLEIGVQNGGSLDIWNKYFPN
AKNIIGCDINPDCLKLNYDNSKIKVVIGNSSTVDVMNEIRTLSADFDVIIDDGSHNSSDI
IKSFLLYYPLLKEGGLYIIEDLHCSYWQEFEGGLYDPWSSMAFLKKLADVPNREHWGTEL
TAGEYLRPFYTHYESEHLDQVDYSSIHSVTFLNSLCIIKKNPSNENVLGRRHVVGEDETV
VAGNKAVDGSLMSVPDQSENLWSHLPTHPEMEWQKLVLSERALFTKLTSETETLQQTQLD
LEQAKQRLDSELIFYKSIEDVLKKELAQTQVALKSQQELANRLAYENHALLTSTSWRLTD
PMRKGVTFSRKAKKAIIIALRILKTHGVEKTARKGYSVLRRDGVSGVIDRLRHMGQVQTV
HHQIVTAKVLPALTLSAEDVLVPRILIIAEMSIPQCRKYRVDQKAELFKKLNIPVTVLDW
TDMNACMNALQSHSAVIFYRVPAFESVHQIFNECDRLNLPTWWEVDDLIFDAEILKNSRT
INELDADTVRGLLDGAHLYRSAMLRCKSGIASTVHLAEAMESCGIKQTVVVENALDPETI
ISAQSLTDTRKSESDGIVRIVYGSGTSTHNVDFEEASDAILNILKRNPNVHFRLIGVLKL
PESFESVKSQIERIDFCAYTDYLKILNECDISIAPLEDYIFNNSKSNIKYIEASIIGLPS
ICSPRPTFAQVITHEVNGYLCSTTEEWEDAFQQLISSPELRRKIGQEAKLNVLHHYSPEN
IAVEQVSKILAGFGRLQSVSNKKQVLSVNCFYHPRSFGGATVVAEALNKRFYDNENIDLH
VLTSLSEDYGPLNTLRRYEAFGQDCYGIVIPNILSENQQIINHDIDHAFKQALDLVKPDL
VHFHSIQGLGITMLDICKQRNIKIVVTTHDYWWLYDHQFILSFDEKHKNRGIKNNIDSKI
ALESDSDYFQIKKRKALELADCIIAPSRFTTELYHLEGFGIASLNKNGVTFPTKLSDKKP
ARPLRFGYVGGNTDIKGFHLIKKVFSKLSAEDACLVIVDNTLNLGYRSFSDHDLSGFKNV
EVIPAFTQANMDEFYDSIDVLLYPTQSKESFGLTVREALIRNVWVITSDAGGAAEDIIVG
ENGYVIPFNNNPDDLQGAVQQTLNWFANRNPSEITRLPHSHVRSFDEQYDELADIYLEML
K

Enzyme Prediction     

No EC number prediction in MGYG000003377_03830.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03823	GT4_ExpE7-like	1.03e-74	804	1197	1	356	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
cd03801	GT4_PimA-like	6.11e-24	814	1196	10	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	2.78e-23	805	1201	2	379	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
COG0438	RfaB	2.37e-16	396	790	9	374	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	1.95e-15	586	790	164	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHI46789.1	0.0	1	1201	1	1181
QRY01615.1	0.0	1	1201	1	1181
BBS39836.1	0.0	1	1201	1	1181
QHJ32724.1	0.0	1	1197	1	1186
QHJ35874.1	0.0	1	1197	1	1186

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3SSM_A	1.28e-16	41	170	221	356	MycEMethyltransferase from the Mycinamycin Biosynthetic Pathway in Complex with Mg and SAH, Crystal form 1 [Micromonospora griseorubida],3SSM_B MycE Methyltransferase from the Mycinamycin Biosynthetic Pathway in Complex with Mg and SAH, Crystal form 1 [Micromonospora griseorubida],3SSM_C MycE Methyltransferase from the Mycinamycin Biosynthetic Pathway in Complex with Mg and SAH, Crystal form 1 [Micromonospora griseorubida],3SSM_D MycE Methyltransferase from the Mycinamycin Biosynthetic Pathway in Complex with Mg and SAH, Crystal form 1 [Micromonospora griseorubida],3SSN_A MycE Methyltransferase from the Mycinamycin Biosynthetic Pathway in Complex with Mg, SAH, and Mycinamycin VI [Micromonospora griseorubida],3SSN_B MycE Methyltransferase from the Mycinamycin Biosynthetic Pathway in Complex with Mg, SAH, and Mycinamycin VI [Micromonospora griseorubida],3SSN_C MycE Methyltransferase from the Mycinamycin Biosynthetic Pathway in Complex with Mg, SAH, and Mycinamycin VI [Micromonospora griseorubida],3SSN_D MycE Methyltransferase from the Mycinamycin Biosynthetic Pathway in Complex with Mg, SAH, and Mycinamycin VI [Micromonospora griseorubida],3SSO_A MycE Methyltransferase from the Mycinamycin Biosynthetic Pathway in Complex with Mg and SAH, Crystal form 2 [Micromonospora griseorubida],3SSO_B MycE Methyltransferase from the Mycinamycin Biosynthetic Pathway in Complex with Mg and SAH, Crystal form 2 [Micromonospora griseorubida],3SSO_C MycE Methyltransferase from the Mycinamycin Biosynthetic Pathway in Complex with Mg and SAH, Crystal form 2 [Micromonospora griseorubida],3SSO_D MycE Methyltransferase from the Mycinamycin Biosynthetic Pathway in Complex with Mg and SAH, Crystal form 2 [Micromonospora griseorubida],3SSO_E MycE Methyltransferase from the Mycinamycin Biosynthetic Pathway in Complex with Mg and SAH, Crystal form 2 [Micromonospora griseorubida],3SSO_F MycE Methyltransferase from the Mycinamycin Biosynthetic Pathway in Complex with Mg and SAH, Crystal form 2 [Micromonospora griseorubida]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AJU2	2.41e-19	12	169	165	326	8-demethyl-8-alpha-L-rhamnosyl tetracenomycin-C 2'-O-methyltransferase OS=Streptomyces olivaceus OX=47716 GN=elmMI PE=1 SV=1
Q83WF2	5.90e-16	41	170	201	336	Mycinamicin VI 2''-O-methyltransferase OS=Micromonospora griseorubida OX=28040 GN=mycE PE=1 SV=1
Q9AJU1	4.12e-14	15	176	172	342	8-demethyl-8-(2-methoxy-alpha-L-rhamnosyl)-tetracenomycin-C 3'-O-methyltransferase OS=Streptomyces olivaceus OX=47716 GN=elmMII PE=1 SV=1
Q9ZHQ4	1.35e-13	41	169	197	331	Demethylmacrocin O-methyltransferase OS=Streptomyces fradiae OX=1906 GN=tylE PE=1 SV=1
O87833	2.99e-13	16	152	166	308	L-olivosyl-oleandolide 3-O-methyltransferase OS=Streptomyces antibioticus OX=1890 GN=oleY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003377_03830.