CAZyme Information: MGYG000003378_00477

Basic Information

• Species: Chimaeribacter arupi
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Chimaeribacter; Chimaeribacter arupi
• CAZyme ID: MGYG000003378_00477
• CAZy Family: GH8
• CAZyme Description: Minor endoglucanase Y

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335	MGYG000003378_11|CGC1	37887.09	6.8467

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003378	4918955	MAG	United States	North America

• Gene Location: Start: 16367; End: 17374 Strand: +

Full Sequence      

MMSTVRRMALIFGLALSLFSSLACAQETGWDQYKTRFLMPDGRIVDTANRNVSHTEGQGF
SMLLAVFNDDRATFDQLLKWADKTLYRKDVGLYAWRYDPNAKDKVADKNNASDGDMLMAW
ALLLAGEKWHNSVYTDASEKLQAAIVKHNVIEFAGHTVMLPGIYGFNHTSTITLNPSYFL
FPAWKAFYQHSHLKVWKSLNDDGLALLKQMDFGKVGLPTDWVTMQADGTLTPGKGWPPRF
SYDAIRIPLYISWAEPNSPALQPFIRYWQGYPRENTPAFIDVQSGAKADYPLSPGMLAIR
DVTLGNNFYVNDTLTPDDGYYSSALQQLAYWSLQK

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	29	330	2.9e-81	0.98125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	4.21e-98	23	330	1	316	Glycosyl hydrolases family 8.
COG3405	BcsZ	7.52e-59	2	329	1	340	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	6.93e-46	2	286	1	293	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCR34663.1	2.09e-205	1	334	1	332
QQN34133.1	1.11e-164	2	335	1	336
AYA05115.1	2.24e-164	2	335	1	336
AZP40413.1	2.24e-164	2	335	1	336
AFE56372.1	2.24e-164	2	335	1	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GY3_A	2.99e-121	27	334	1	307	ChainA, Glucanase [Klebsiella pneumoniae]
5CZL_A	2.37e-117	27	330	29	331	ChainA, Glucanase [Raoultella ornithinolytica]
6VC5_A	1.71e-70	21	330	1	310	1.6Angstrom Resolution Crystal Structure of endoglucanase from Komagataeibacter sucrofermentans [Komagataeibacter sucrofermentans]
1WZZ_A	8.43e-62	23	330	18	325	Structureof endo-beta-1,4-glucanase CMCax from Acetobacter xylinum [Komagataeibacter xylinus]
3QXQ_A	1.62e-33	30	325	7	315	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27032	2.78e-124	12	328	9	325	Minor endoglucanase Y OS=Dickeya dadantii (strain 3937) OX=198628 GN=celY PE=1 SV=1
P18336	7.44e-116	27	305	24	302	Endoglucanase OS=Cellulomonas uda OX=1714 PE=1 SV=1
P37696	1.32e-62	23	330	26	333	Probable endoglucanase OS=Komagataeibacter hansenii OX=436 GN=cmcAX PE=1 SV=1
Q8X5L9	1.51e-35	5	325	3	336	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
P37651	5.69e-35	5	325	3	336	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001486	0.777467	0.220030	0.000456	0.000272	0.000250

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003378_00477.