CAZyme Information: MGYG000003378_02215

Basic Information

• Species: Chimaeribacter arupi
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Chimaeribacter; Chimaeribacter arupi
• CAZyme ID: MGYG000003378_02215
• CAZy Family: GT107
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
681	MGYG000003378_59|CGC2	74992.51	9.7769

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003378	4918955	MAG	United States	North America

• Gene Location: Start: 31018; End: 33063 Strand: -

Full Sequence      

MIGIHSAGIRRIPALGHFLPQAFCPLSLSRQPAAGLSAVAVWGHRPTAVRPVAWAARHGL
PVLRLEDGFIRSLGLGVSGEPPLSMVVDTLGIYYDARQTSTLEQLIQERSTDPALMDAAR
QAMAFIVEQDISKYNQAPPFNGRAPENGAVLVVDQTFGDMAVTFGQAGEDHFTAMLQAAM
DEHPEAEIWVKIHPDVLSGKKRGYLGKQALYAAAHDKRVKLLAQDVSPQSLLRQVTEVYA
VTSQYGFEALLAGKRVHCFGQPWYAGWGVTHDRHPEAAALHARRGAATLSDLFAAAYLRY
SRYIDPLSGKPATLQTVLYWLMAARQFRDSRPGTLFVPGLSLWKKSILHPFLHSRNAPVR
YRAPTPRGTACVVWGVKGERRWQPAADRAGLPVWRMEDGFLRSSGLGSDLYPPLSLVLDT
CGIYYDATRPSDLETSLITRPVTPAQQQRARALRTRLVAAKVSKYNLGAPFALPPEAVGK
RVLLVPGQVEDDASIATGALGIATNQALLETVRARNPDAFIIYKPHPDVLAGNRRGHIAP
RLMASLADQVAEDADIIDCIHACDELHTLTSLAGFEALLHGKTVFCYGMPFYAGWGLTHD
ALSLARRTARLSLDALVYHTLISYPTYIHPRRRQPMSAEQAITTIEMMPRADMSMGNKKF
STLRRHCRKALMLIKVKFSLF

Enzyme Prediction     

No EC number prediction in MGYG000003378_02215.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT107	304	670	1.2e-137	0.6954887218045113
GT107	29	326	9.5e-105	0.543233082706767

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3563	KpsC	0.0	4	677	6	664	Capsule polysaccharide export protein KpsC/LpsZ [Cell wall/membrane/envelope biogenesis].
cd16439	beta_Kdo_transferase_KpsC_2	5.63e-158	372	627	4	259	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat 2. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16440	beta_Kdo_transferase_KpsC_1	9.36e-149	39	306	1	262	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat1. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	2.35e-116	371	627	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	4.16e-110	39	303	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYA06312.1	1.32e-291	1	676	1	675
AZP50362.1	1.32e-291	1	676	1	675
AZP45886.1	1.87e-291	1	676	1	675
AZP41545.1	1.87e-291	1	676	1	675
AFE57557.1	1.87e-291	1	676	1	675

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MGC_A	1.52e-137	2	354	3	351	Escherichiacoli KpsC, N-terminal domain [Escherichia coli APEC O1]
6MGB_A	1.15e-74	2	325	11	325	Thermosulfurimonasdismutans KpsC, beta Kdo 2,4 transferase [Thermosulfurimonas dismutans]
6MGD_A	1.45e-65	372	642	47	315	Thermosulfurimonasdismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans],6MGD_B Thermosulfurimonas dismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42217	3.89e-281	1	679	1	675	Capsule polysaccharide export protein KpsC OS=Escherichia coli OX=562 GN=kpsC PE=4 SV=1
P57037	2.01e-196	4	641	26	667	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=lipA PE=4 SV=1
Q05013	4.58e-195	4	641	26	667	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lipA PE=4 SV=2
P31858	2.08e-57	339	647	80	401	Lipopolysaccharide-processing protein LpsZ OS=Rhizobium meliloti OX=382 GN=lpsZ PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000010	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003378_02215.