CAZyme Information: MGYG000003378_02606

Basic Information

• Species: Chimaeribacter arupi
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Chimaeribacter; Chimaeribacter arupi
• CAZyme ID: MGYG000003378_02606
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
609		66881.98	4.6986

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003378	4918955	MAG	United States	North America

• Gene Location: Start: 38857; End: 40686 Strand: +

Full Sequence      

MTMTSTQNIALNSIALSLGLCAFLPLQAAETKSSEPYVVQYSDLVKKEKEMTTDPLMLKV
KESIRTLDNSVVEAIEPGKPSNPENVKRVEKILTNKDWEYIFPLRAPEYSYSNFLKALGK
FPAVCGTYTDGRDSEAICRKVLATMFAHFAQETGGHESWRPEAEWRQGLVWLREMGWAEG
QLGGYNGECNPDVWQGQTWPCGKDAEGNFLSYFGRGAKQLSYNYNYGPFSDAMYGTVRTL
LDRPDLVADTWLNLASAVFFFVYPQPPKPSMLHVIDGTWVPNDHDKANGLVPGFGTSIQI
INGGVECGGPQDIAQGLNRISYYKSEAEYLKVPVPADEVLGCANMKQFDEGGAGALPIYW
EQDWGWSADTPDGKTYACKLVGYQTPFTAFKEGDYVRCVEHNFNVKIEGAPGEGGTVPQP
TPAPQPTPAPQPAPQPTPAPQPTPAPQPTPVVPENSAPVAVISGPIGTVESQANVTLNAG
ESHDADGDTLSYHWLLPNGRSLTDRNSLSFVAPVVTLDSTYKFTLTVSDGKTSSVARYEL
KVSPKKAPIPDTTTGCANSWEQDKVYYGGESVVWKGNEYRANYWTQNNEPGNPDFTGDWS
QWKLIKSCK

Enzyme Prediction     

No EC number prediction in MGYG000003378_02606.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	85	342	7.2e-70	0.9956709956709957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00325	chitinase_GH19	1.71e-70	93	342	1	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	2.99e-35	109	333	25	225	Chitinase class I.
COG3979	COG3979	4.98e-29	71	227	39	181	Chitodextrinase [Carbohydrate transport and metabolism].
cd12215	ChiC_BD	1.70e-09	560	604	3	42	Chitin-binding domain of chitinase C. Chitin-binding domain of chitinase C (ChiC) of Streptomyces griseus and related proteins. Chitinase C is a family 19 chitinase, and consists of a N-terminal chitin binding domain and a C-terminal chitin-catalytic domain that effects degradation. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source. ChiC contains the characteristic chitin-binding aromatic residues.
pfam18911	PKD_4	4.83e-07	451	530	5	80	PKD domain. This entry is composed of PKD domains found in bacterial surface proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCR35200.1	0.0	5	609	4	612
AVF34019.1	0.0	11	609	10	597
AEX53498.1	0.0	11	609	10	594
AZP52416.1	0.0	11	609	10	594
AFE59861.1	0.0	11	609	10	594

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BAA_A	1.37e-30	109	332	29	228	TheRefined Crystal Structure Of An Endochitinase From Hordeum Vulgare L. Seeds To 1.8 Angstroms Resolution [Hordeum vulgare]
7V92_A	2.68e-30	109	351	29	245	ChainA, GH19 Chitinase [Ficus microcarpa],7V92_B Chain B, GH19 Chitinase [Ficus microcarpa],7V92_C Chain C, GH19 Chitinase [Ficus microcarpa],7V92_D Chain D, GH19 Chitinase [Ficus microcarpa]
4DWX_A	9.15e-30	109	348	30	243	CrystalStructure of a Family GH-19 Chitinase from rye seeds [Secale cereale],4DWX_B Crystal Structure of a Family GH-19 Chitinase from rye seeds [Secale cereale],4DYG_A Crystal Structure of a Family GH-19 Chitinase from rye seeds in complex with (GlcNAc)4 [Secale cereale],4DYG_B Crystal Structure of a Family GH-19 Chitinase from rye seeds in complex with (GlcNAc)4 [Secale cereale]
4J0L_A	1.25e-29	109	348	30	243	CrystalStructure of a Family GH19 Chitinase (W72A/E67Q mutant) from rye seeds in complex with two (GlcNAc)4 molecules [Secale cereale]
1CNS_A	2.28e-29	109	332	29	228	CrystalStructure Of Chitinase At 1.91a Resolution [Hordeum vulgare],1CNS_B Crystal Structure Of Chitinase At 1.91a Resolution [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P52404	1.96e-34	109	351	94	310	Endochitinase 2 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB2 PE=2 SV=1
P24091	3.20e-34	109	351	102	318	Endochitinase B OS=Nicotiana tabacum OX=4097 GN=CHN50 PE=1 SV=1
P52403	3.84e-34	109	351	96	312	Endochitinase 1 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB1 PE=2 SV=1
P08252	6.70e-34	109	351	107	323	Endochitinase A OS=Nicotiana tabacum OX=4097 GN=CHN48 PE=1 SV=2
P52405	1.35e-33	109	351	96	312	Endochitinase 3 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001038	0.810438	0.187698	0.000329	0.000266	0.000221

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003378_02606.