CAZyme Information: MGYG000003378_04401

Basic Information

• Species: Chimaeribacter arupi
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Chimaeribacter; Chimaeribacter arupi
• CAZyme ID: MGYG000003378_04401
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
166		18491.44	9.9968

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003378	4918955	MAG	United States	North America

• Gene Location: Start: 1922; End: 2422 Strand: -

Full Sequence      

MRLFIHAAALLATGIFSASVNADCFIKAGEWYSIDPDYLRAIAWQESRYNPAAINTNKTK
DGKPGSSDYGIMQINSVTMRGLQKEYPGLSKEKLLSDPCLNIFIGAMLLRRNFNQYGTTW
LAVGMYNAGMKNIPVTIKNRYNYAMIIDAHYKAIKAGKIPRTAING

Enzyme Prediction     

No EC number prediction in MGYG000003378_04401.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	35	141	1.7e-17	0.7111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	2.19e-41	32	152	1	108	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15328	PRK15328	7.52e-30	1	156	2	144	type III secretion system invasion protein IagB.
PRK13722	PRK13722	7.40e-25	23	162	21	156	lytic transglycosylase; Provisional
pfam01464	SLT	1.14e-23	25	144	1	110	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	2.73e-12	36	132	1	84	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAV47616.1	5.55e-111	1	166	1	166
QAV52180.1	5.55e-111	1	166	1	166
QDY44254.1	3.75e-109	1	166	1	166
QHM74036.1	6.48e-89	16	164	56	204
QGY32547.1	1.38e-72	1	161	1	161

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	3.71e-13	23	112	2	85	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q00739	5.42e-26	23	158	21	149	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
Q07568	6.91e-26	21	156	17	143	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1
P17738	7.65e-26	23	158	21	149	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
P14499	1.08e-25	22	162	20	156	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
P47737	1.08e-25	23	162	21	156	X polypeptide OS=Escherichia coli (strain K12) OX=83333 GN=yubQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000238	0.999104	0.000173	0.000172	0.000150	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003378_04401.