CAZyme Information: MGYG000003379_00584

Basic Information

• Species: Pantoea anthophila
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pantoea; Pantoea anthophila
• CAZyme ID: MGYG000003379_00584
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1338	MGYG000003379_6|CGC1	148256.43	6.031

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003379	4490212	MAG	United States	North America

• Gene Location: Start: 61209; End: 65225 Strand: -

Full Sequence      

MKNILALNFFPAFVPVSNGGESKLYNFYKALSKYHHVTLLTSTHPDVSEEIIYHTSTFIE
RRIPKDHYFMNCWSELSQYLTEGHGDLSAPTIAASAFYPTLMHAAYLQEYESADIIVHDF
PFTVDFDIFLGADSKPRIYNSHNCETALYSTLHASEKSKPIVDIVARAEKKLLDHADLIL
YCGESDYDSFKNLASHKQPVMFYSPNGMIEHANVSSPRASKQKHSAVFIGSAHLPNVSAA
LYVAENIAPKCPEITFDIIGGCLPEGKYSSNVVRHGRVSDAEKVRIFDNASIALNPMLSG
SGSNIKALDYFSYGLPILSTPFGMRGFNIESGKHYIESKLEDFPQVLNKCLSEEWFNNTL
NIGVEGKLFASANYTWEAIVKKLLPKIESLTSKKTNFALVLNDYNSYSGVGGGATRTRGL
YEAVSEITDVVFLCFSDDGKVHSDTYDKNIHVISLPKSAAHVQEVNDLNSQFHISCDDIV
ASKYCTNNNLLLSVYNLIKKNARFIIVEHPYMTPIPIGLHDRFIYSSQNDETKLKSDLHK
WHPQKDYLVDMVTAVEKNAVEKAALTVAVSEDDAYSLLVGKRSAGPVIVVRNGSQVPVEV
SELVAEKIKSKLRSKSAVFLGSAHMPNVDAVNYLLKHVVPQCPDVQFNIVGSVCNSISVE
PAKNVVLWGMVDEETKCAILENSLFALNPVISGSGSNIKLADFFANGLFVVSTVFGLRGY
PENINKHIALAEPDNFAQVINSLSVSDLCFSEKMRQERKDIFISDLSMVGIARKFVSALE
NLERPKHKVLFVTYRYTHPELGGAESNLKRFLKALGDTNEFEIDVVTTEVSKINNHARFT
ERYEFDHSLGAPIEMANLRFARFSLDDNVDEQNSDLLKKAWRAQVAFEKAVFEKSNVTLV
DGLAWGWSDPEGISTEAYRWGYSSCSVYVSHVGEVSLNGYVPEKAMLTLQSESGAIYLHK
EIEGKFSINVKVQSGIVEIYTSSAFNDGSDPRPLGFILQGLNINDCVIDINQPTLADKNH
ISASNVFDILSEAAEETRFPLNINLTELRGPHSQKMEGFILSNISKYDLVITHNIVFKPA
VFALELAKQNNIPSLLIPHPHLDDDYYHFPDLISAARNATEVLAVPKAASDFYAAKGCCS
SYLPGGADTHEKFVSDDLNAFRNIYQNEDPYLLILGRKSGAKGYRSVIEATEKLSKDGLA
INLVMIGPDDDGVVINSPHVTYLGRQPREVVRGALMGCLALVNMSSSESFGIVLLEAWLA
NKPVVANKSCVAFHDMAVHGENALLVTPEGLPEALTHIVSDSALCQRLASNGFMTAQNFS
WDSVENQFVEICRKRIRS

Enzyme Prediction     

No EC number prediction in MGYG000003379_00584.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	1167	1306	2.9e-19	0.93125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	1.46e-30	1060	1333	76	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	3.57e-24	1040	1337	57	379	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03821	GT4_Bme6-like	3.93e-20	1048	1330	72	377	Brucella melitensis Bme6 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Bme6 in Brucella melitensis has been shown to be involved in the biosynthesis of a polysaccharide.
cd03809	GT4_MtfB-like	1.84e-18	1095	1322	114	354	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03800	GT4_sucrose_synthase	1.89e-18	1056	1324	91	392	sucrose-phosphate synthase and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose 6-phosphate and uridine 5'-diphosphate-glucose, a key regulatory step of sucrose metabolism. The activity of this enzyme is regulated by phosphorylation and moderated by the concentration of various metabolites and light.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCA03860.1	0.0	1	1338	1	1338
ANS42064.1	0.0	1	1333	1	1333
AWU66553.1	0.0	1	1337	6	1342
AWU66568.1	0.0	1	1337	1	1337
AWU66601.1	0.0	1	1337	1	1337

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48455	8.66e-07	609	734	205	343	Uncharacterized 44.6 kDa protein in cps region OS=Klebsiella pneumoniae OX=573 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003379_00584.