CAZyme Information: MGYG000003379_01146

Basic Information

• Species: Pantoea anthophila
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pantoea; Pantoea anthophila
• CAZyme ID: MGYG000003379_01146
• CAZy Family: GT2
• CAZyme Description: Glucans biosynthesis glucosyltransferase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
850		96785.19	9.4829

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003379	4490212	MAG	United States	North America

• Gene Location: Start: 698755; End: 701307 Strand: +

Full Sequence      

MNKSTFTPQRYVESLPLDAAGKSRLSVSLQNASAFHFIHDVLGRDVAASDRPDDAPLKSV
SSRVEMAWPDALAGGQQLGKDYLDRTTLKAMPKVKRSLMFPEAWRTNPVARAWDSLRGRK
SVPRYASAEEQRAEEKWRHVGSIRRYILLILTIFQTVVATWYMKSILPYQGWTLLDPMEM
INQNWQQSVMQILPYVLQTGILFLFAILFCWVSAGFWTALMGFLQLLIGRDKYSISYSTV
GDEPLNPAHRTALIMPICNEDVERVYAGLRATWESVVRTGNAEHFDVYILSDSYDADIAV
AEQKAWMELVRDVGGAGKIFYRRRRRRVKRKSGNIDDFCRRWGSNYSYMVVLDADSVMSG
ECLTGLVRMMEANPNAGIIQSSPKASGMDTLYARCQQFATRVYGPLFTAGLHFWQLGESH
YWGHNAIIRVKPFIEHCALAPLPGEGSFAGSIMSHDFVEAALMRRAGWGVWIAYDLPGSY
EELPPNLLDELKRDRRWCHGNLMNFRLFLVKGMHPVHRAVFLTGVMSYLSAPLWFLFLAL
STALQVVHTLMEPTYFLQPRQLFPVWPQWRPELAIALFSTTMVLLFLPKLLSVVLIWFKG
AKPYGGALRVLLSLVLETLFSVLLAPVRMLFHTVFVVSAFLGWEVVWNSPQRDDDATPWG
EAFKRHGSQMALGLVWAIGMGLLDLNFLWWLAPIVFSLILSPFVSVMSSRATLGLKSKRA
KLFLIPEESSPPQELVDTDRYLQLNRERVLENGFMHALFHPAFNALATALATSRHRQSQL
LDYARDRRVDQALSDAPEKLSRDQRLQLISDPVVLARVHTRLWENAEKYHQWVESYQKLT
LNPNALAKNA

Enzyme Prediction     

No EC number prediction in MGYG000003379_01146.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	253	435	3.6e-23	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2943	MdoH	0.0	64	838	1	735	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].
PRK05454	PRK05454	0.0	84	723	3	599	glucans biosynthesis glucosyltransferase MdoH.
cd04191	Glucan_BSP_MdoH	1.28e-152	251	504	1	254	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.
cd06423	CESA_like	1.14e-12	253	441	1	174	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam00535	Glycos_transf_2	3.09e-12	254	433	3	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZX94463.1	0.0	1	850	1	850
AVV37399.1	0.0	1	850	1	850
QCA04823.1	0.0	1	850	1	850
QPG25900.1	0.0	1	850	1	850
AYP23730.1	0.0	1	850	1	850

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4ZZH4	0.0	11	845	14	843	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=opgH PE=3 SV=1
Q87UY1	0.0	1	845	1	842	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) OX=223283 GN=opgH PE=3 SV=1
Q82SA8	0.0	1	846	1	839	Glucans biosynthesis glucosyltransferase H OS=Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) OX=228410 GN=opgH PE=3 SV=1
Q6D6A7	0.0	1	839	1	847	Glucans biosynthesis glucosyltransferase H OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=mdoH PE=3 SV=1
Q88D04	0.0	1	837	1	830	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
146	163
201	223
519	541
575	597
610	632
687	709