CAZyme Information: MGYG000003379_01176

Basic Information

• Species: Pantoea anthophila
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pantoea; Pantoea anthophila
• CAZyme ID: MGYG000003379_01176
• CAZy Family: GH73
• CAZyme Description: Peptidoglycan hydrolase FlgJ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319		34928.72	8.2633

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003379	4490212	MAG	United States	North America

• Gene Location: Start: 723743; End: 724702 Strand: +

Full Sequence      

MADMQSVMSAAYDSRSLNELKHQASNDPKGHALQVARQVEGMFVQMMLKSMREALPQDGI
MSNEQTKLFTSMYDQQIAQEMGKRGLGLAETIVKQMQPAVAPDEKAGTVPMKLDNSFILS
TSGATPMPAQQLEQMVRKAMPRLPAASPTGLPSDSREFIAQLTQPAQAASQQSGIPHHLI
LAQAALESGWGQRQILTRDGKPSYNVFGIKASGDWKGDTTDIMTTEYEQGEAKKVRASFR
VYNSYFEALTDYVRLLTKNPRYAAVTNASSAEQGAQALQAAGYATDPKYAQKLVGMIQQF
KSMGDKVVKAYSQDIGDLF

Enzyme Prediction     

No EC number prediction in MGYG000003379_01176.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	164	300	1.4e-35	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05684	flgJ	1.03e-176	1	315	1	312	flagellar assembly peptidoglycan hydrolase FlgJ.
TIGR02541	flagell_FlgJ	2.33e-120	10	301	1	294	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
PRK12712	flgJ	8.70e-91	11	299	17	341	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK12713	flgJ	7.76e-82	7	302	12	328	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK12709	flgJ	7.56e-80	11	299	15	318	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA51144.1	4.87e-213	1	319	1	320
AYP23701.1	4.87e-213	1	319	1	320
AOE40896.1	4.87e-213	1	319	1	320
QCA04793.1	4.87e-213	1	319	1	320
QGY58553.1	4.87e-213	1	319	1	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN4_A	4.49e-79	154	319	2	167	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN5_A	1.08e-73	154	303	2	151	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	1.86e-36	155	297	1	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	2.42e-36	155	297	2	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	1.86e-35	155	297	2	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P58231	2.57e-128	1	319	2	313	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
P75942	7.35e-128	1	319	2	313	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P15931	1.09e-125	1	319	2	316	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
Q9X9J3	3.05e-41	12	303	12	308	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9I4P4	1.62e-40	13	302	20	387	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003379_01176.