CAZyme Information: MGYG000003379_03964

Basic Information

• Species: Pantoea anthophila
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pantoea; Pantoea anthophila
• CAZyme ID: MGYG000003379_03964
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
689	MGYG000003379_26|CGC3	76763.56	7.5349

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003379	4490212	MAG	United States	North America

• Gene Location: Start: 333412; End: 335481 Strand: -

Full Sequence      

MKTNPVKDDFSVAGIAAEYINAHGRPQAIPALTRQRLLAVMQPPRQQSTPLPPVVIFRSG
DLLSLSPQLTQDAQWQLTREAGGVTSGRCHPAQPLHLPPLPEGYHQLTLQQGARQWSCRI
IIAPPRCYEPPALQAGESLWGACVQLYTLRSAENWGIGDFGDLRRMLPAVAARGGAFIGL
NPIHALFPSSPESASPYSPSSRRWLNVLYIDVNAVSDFRQSSAAQAWWQQPETQQALTQA
RAAEWVDYAAVTRLKITALSLAWPQFSQREATDPEVQAFHAFIKEGGISLQHQALFDALH
ADQIAQDSQRWGWPVWPEALQDPASPAVKTFLQQHADQVRFWLWLQWLAAQQFADCWQGC
QQQAMPIGLYRDLAVGVAKGGAETWSDRDLYCMEASIGAPPDILGPRGQDWGLPPMDPQV
MQQRAWEPWIALLRANMRHCGALRIDHVMALMRLWWIPAGEPAMHGAYVHYPIDDLLAIL
ALESQRHRCMVIGEDLGTVPEAIVDKLRDGGVYSYKVLWFEQTSPSGFRPPAAWPRQAMA
VATTHDLPTLRGWWQSDDLTTGARLGLYPDKVVLAGLYQDRLRAKQALLNSLHQVGALPK
RAGRSAGRTGMSKALNRAMQRYLADSHSALLGLQPEDWLDMATPVNIPGTSDEYPNWRRK
LSVTLEALFSDAETRALLRDLTARRKQSA

Enzyme Prediction     

EC	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	144	683	1e-162	0.9898785425101214

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00217	malQ	0.0	126	681	2	511	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1640	MalQ	0.0	127	686	1	517	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PRK11052	malQ	0.0	1	687	1	691	4-alpha-glucanotransferase; Provisional
PRK14507	PRK14507	0.0	13	685	15	721	malto-oligosyltrehalose synthase.
pfam02446	Glyco_hydro_77	0.0	144	664	1	460	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOE42095.1	0.0	1	687	1	687
AYP25386.1	0.0	1	687	1	687
QAV47120.1	0.0	1	687	1	687
QAV51751.1	0.0	1	687	1	687
AZI53133.1	0.0	1	687	1	687

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3P_A	2.47e-316	13	684	13	686	AmylomaltaseMalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3P_B Amylomaltase MalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3Q_A Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_B Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_C Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12]
4S3R_A	6.99e-304	13	684	13	686	AmylomaltaseMalQ from Escherichia coli in complex with the pseudo-heptasaccharide acarviosine-glucose-acarbose [Escherichia coli K-12]
5B68_A	9.69e-78	35	657	58	673	Crystalstructure of apo amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum],5JJH_A Crystal structure of amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum]
1TZ7_A	6.84e-17	248	556	117	415	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]
5CPQ_A	2.56e-16	295	599	206	511	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15977	3.79e-317	13	689	13	691	4-alpha-glucanotransferase OS=Escherichia coli (strain K12) OX=83333 GN=malQ PE=1 SV=2
P45176	1.52e-165	63	671	74	683	4-alpha-glucanotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=malQ PE=3 SV=1
P65337	6.89e-99	14	677	16	709	4-alpha-glucanotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=malQ PE=3 SV=1
P9WK23	6.89e-99	14	677	16	709	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=malQ PE=1 SV=1
P9WK22	6.89e-99	14	677	16	709	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003379_03964.