CAZyme Information: MGYG000003380_00200

Basic Information

• Species: Corynebacterium aurimucosum_E
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium aurimucosum_E
• CAZyme ID: MGYG000003380_00200
• CAZy Family: GT87
• CAZyme Description: Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393	MGYG000003380_6|CGC2	43187.64	7.7485

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003380	2319588	MAG	United States	North America

• Gene Location: Start: 32981; End: 34162 Strand: -

Full Sequence      

MKKSLWFTALPLCLSALVALWWLIDIPELFSGHFSTYYHIDLDVYREGGAGFGSDLYAKD
YLVGSNRDVSLPFTYPPFAALLFAPLSWIPLTAASILVSVASLLALWVCVALVLRSLGCP
GWAGWALLAAMLTEPITETFSFGQVNILLTALVVADILWLRPGRGRGVLTGIAMAIKLTP
AVFLAVFFVRREWRAFFSALGSFLAAGLIAFACNPHSSIQYWSETLRDSNRIGGLAYSSN
QSLRGLFSRLVPEHAEKLWLVAVVLVVAIVWFAMERLSHGNQAVLMLLAASVSLLCSPVS
WSHHFTWLVLAGVLLVAQRHWALGALTWLALFARGHWLVPHANDQELDWAWWQHIVGNDY
AIVTALLVLCSLPLALRRAGVYQSAAEPASSQG

Enzyme Prediction     

No EC number prediction in MGYG000003380_00200.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT87	73	298	1.1e-70	0.9956709956709957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13375	pimE	6.15e-39	40	390	45	408	mannosyltransferase; Provisional
pfam09594	GT87	8.09e-35	73	298	1	237	Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQU82094.1	1.23e-275	1	393	1	393
QQA98319.1	2.90e-274	1	393	1	393
QRQ66188.1	5.85e-274	1	393	1	393
QQN48578.1	1.16e-264	1	393	1	393
VEH73286.1	4.76e-223	2	393	6	395

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMZ8	6.17e-52	32	377	39	409	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2236 PE=3 SV=1
P9WMZ9	6.17e-52	32	377	39	409	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2181 PE=1 SV=1
A0R036	1.25e-49	38	360	45	400	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_4247 PE=1 SV=1
A0R2K8	6.74e-30	40	364	57	395	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=pimE PE=1 SV=2
P9WN00	2.15e-28	40	364	69	408	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pimE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.985908	0.012663	0.001194	0.000027	0.000025	0.000201

TMHMM  Annotations     

start	end
5	24
75	97
104	126
141	160
167	189
193	212
257	274
284	301
308	330
350	372