CAZyme Information: MGYG000003381_01159

Basic Information

• Species: Lachnoanaerobaculum sp000296385
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoanaerobaculum; Lachnoanaerobaculum sp000296385
• CAZyme ID: MGYG000003381_01159
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
636		71978.3	6.6617

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003381	2661892	MAG	United States	North America

• Gene Location: Start: 1917; End: 3827 Strand: -

Full Sequence      

MHLNKFIKTAISLSLALSLLSPVTSFAANEWTMQTPGVYQMLDGSSLTGVVARGIDLSHY
QGDVDWDKVAADDVQFIIHGTRYKGQIDPVIRRNLTEANKRGIKLGVYIYSYAMTVAQAD
AEADFVLDIIKDYPISYPVAFDVEDANTQGKLPKDELTAIIKTFCNKVEAAGYYPIVYAN
DYWIANKLDMNALKKYDIWVARYNVKHSYPDPVIWQATSTGKVNGIKGNVDIDFQYKSFS
DKIPANTWRTIAGKRYYYKDYNMVKDSWVHDSNNSYYMDSNGTAKTGWFTSNNASYYLDP
SKNGAAKKGWYKENSDWYYLDSTDGKMITGWINDGNKRYYADKDGKMQTGWLVDGKNTYF
LAPSGVMTTGWVNDNNTWYYMDNNGRMQTGWIDTGNQRYYMDNTGKMQTGWTDIGNSRYF
LTKSGAMYKGWLNDSGAWYYLDNNGVMKTGWINDKNTWYYTDNTGKMQTGWINDGKNRYF
LTDSGAMKTGWLKDGNDWYYIDKSGSISTGWVNDGGTWYYLDGSGKMQTGWIDLNNQRYF
LSPSGAMKTGWINVDKNWYYMNSSGNMARGMINVNNVSYYLDESGKMLVNTTVNVNGTDY
RIDASGAMSQIVPEITATPETSAAVSTQASVGSKAQ

Enzyme Prediction     

No EC number prediction in MGYG000003381_01159.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	55	226	2.6e-44	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	1.89e-72	53	236	2	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
NF033930	pneumo_PspA	3.16e-63	305	518	440	659	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	5.47e-63	348	606	442	657	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	1.49e-58	369	606	486	680	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033930	pneumo_PspA	2.18e-58	408	609	442	643	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYA98687.1	3.67e-155	1	343	1	343
QUI96762.1	8.73e-85	4	273	5	278
QQR03194.1	1.35e-76	29	267	78	313
ANU47907.1	1.35e-76	29	267	78	313
QRP37172.1	1.46e-75	29	267	78	313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JFX_A	6.64e-06	53	231	6	198	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000298	0.998902	0.000241	0.000190	0.000192	0.000169

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003381_01159.