CAZyme Information: MGYG000003382_03616

Basic Information

• Species: Pantoea agglomerans
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pantoea; Pantoea agglomerans
• CAZyme ID: MGYG000003382_03616
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
239	MGYG000003382_38|CGC2	26730.83	10.6356

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003382	4723531	MAG	United States	North America

• Gene Location: Start: 70080; End: 70799 Strand: +

Full Sequence      

MNKHKGSVGQRIRRIVGRIVLVLLGIWLAGILLFSFLPVPFSAVMAERQIGAWLRGDFSY
VAHSDWVGHDEISPWMGLAVIASEDQKFPTHWGFDVAAIESVLDNSDSRMRGASTLSQQT
AKNLFLWDGRSWVRKGLEAGLTVGIETVWTKRRILTVYLNIAEFGPGIFGVEAASQRYFH
KPASRLTAADAALLAAVLPNPIRYRAAAPSGYVRERQQWILRQMRQLGGEGFLQRNQLD

Enzyme Prediction     

EC	2.4.1.129

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	61	225	4.4e-53	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	6.59e-127	10	236	6	235	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	4.40e-80	13	230	1	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.59e-70	6	238	19	254	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	6.62e-56	60	225	9	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	1.39e-26	70	228	73	234	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOE39990.1	4.48e-171	1	239	1	239
QAV43270.1	4.48e-171	1	239	1	239
QTC50233.1	4.48e-171	1	239	1	239
QGY59510.1	4.48e-171	1	239	1	239
QIA53543.1	4.48e-171	1	239	1	239

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.48e-22	66	228	22	187	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	2.07e-22	66	228	22	187	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	1.53e-20	79	228	54	206	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
7U4H_A	2.92e-20	79	204	55	181	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3UDF_A	1.36e-16	40	228	20	206	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7MJD8	9.48e-131	1	238	1	240	Biosynthetic peptidoglycan transglycosylase OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=mtgA PE=3 SV=1
Q48465	8.93e-127	12	238	12	241	Biosynthetic peptidoglycan transglycosylase OS=Klebsiella oxytoca OX=571 GN=mtgA PE=3 SV=1
Q8ZLR7	1.72e-124	1	239	1	242	Biosynthetic peptidoglycan transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=mtgA PE=3 SV=1
B7NDJ2	1.72e-124	1	239	1	242	Biosynthetic peptidoglycan transglycosylase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) OX=585056 GN=mtgA PE=3 SV=1
B4T739	1.72e-124	1	239	1	242	Biosynthetic peptidoglycan transglycosylase OS=Salmonella newport (strain SL254) OX=423368 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999973	0.000027	0.000000	0.000000	0.000000	0.000038

TMHMM  Annotations     

start	end
19	41