CAZyme Information: MGYG000003383_00040

Basic Information

• Species: Bifidobacterium scardovii
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium scardovii
• CAZyme ID: MGYG000003383_00040
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
512	MGYG000003383_3|CGC2	52998.68	4.806

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003383	3123324	MAG	United States	North America

• Gene Location: Start: 32616; End: 34154 Strand: -

Full Sequence      

MIRRWTPQRLVMLRRIRVSICVATVTAVAVACFAFTARKTVALTVNGETTTVTTYAMSVD
RLLESQGIDVKTHDLVESTAGGNKLADHAVVTVQSAYQTTITIDGQKVPFWTTATSADQL
LGFFAANEAAAAKVTVNISNVYNKLTGGLVINESGPVTVIADGTSSEAPNGKLPAASILD
SKGITLNKEDRVSVEKDGDRTILRVQRVTHGQETRTVAVPHSTQTVIDSSLQPGEAVIRQ
QGEDGETQQVYDVTYVDGAAESENLISETTTKIALDTVVAVGPEQTASGKDTGNGNASAG
DNTDGKGGDGANGSSTDSKKDTGKTDGKDTGKDAAGTNTGNGSKGDAGNDSGSSSGNTNG
GNASGNTGSGSTGDANASNGTANDSSANDSSASGNTGSGTSDGSASARLWRPTAAQAQTY
AAGAAAQRGWTGNEWNCLVKLWNRESRWLWYAENPSGAYGIPQSLPGSKMAAFGADWRND
AAVQIDWGLSYIAQRYGSPSQAWAHSESAGWY

Enzyme Prediction     

No EC number prediction in MGYG000003383_00040.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3583	YabE	2.34e-32	37	298	36	298	Uncharacterized conserved protein YabE, contains G5 and tandem DUF348 domains [Function unknown].
pfam07501	G5	8.88e-18	212	283	3	74	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
pfam03990	DUF348	7.55e-08	41	77	1	37	Domain of unknown function (DUF348). This domain normally occurs as tandem repeats; however it is found as a single copy in the S. cerevisiae DNA-binding nuclear protein YCR593. This protein is involved in sporulation part of the SET3C complex, which is required to repress early/middle sporulation genes during meiosis. The bacterial proteins are likely to be involved in a cell wall function as they are found in conjunction with the pfam07501 domain, which is involved in various cell surface processes.
NF035936	agg_sub_LPXTH	6.30e-06	286	407	31	157	serine-rich aggregation substance UasX. Members of this protein family are repetitive, serine-rich surface proteins of the Firmicutes, found primarily in the genus Leuconostoc. The variant form of sortase signal, LPXTH, is replaced by LPXTG in members from some lineages, such as Weissella oryzae, and therefore recognizable. Some members of this family have the KxYKxGKxW type signal peptide as seen in the glycoprotein adhesin GspB, a substrate of the accessory Sec system for secretion. WOSG25_050600 from Weissella oryzae SG25 is identified in a publication as an unnamed aggregation substance, a conclusion supported by the sorting signals and composition reported here. We assign the gene symbol uasX (unnamed aggregation substance X) based on our evaluation of the family.
NF035936	agg_sub_LPXTH	6.53e-06	291	402	53	160	serine-rich aggregation substance UasX. Members of this protein family are repetitive, serine-rich surface proteins of the Firmicutes, found primarily in the genus Leuconostoc. The variant form of sortase signal, LPXTH, is replaced by LPXTG in members from some lineages, such as Weissella oryzae, and therefore recognizable. Some members of this family have the KxYKxGKxW type signal peptide as seen in the glycoprotein adhesin GspB, a substrate of the accessory Sec system for secretion. WOSG25_050600 from Weissella oryzae SG25 is identified in a publication as an unnamed aggregation substance, a conclusion supported by the sorting signals and composition reported here. We assign the gene symbol uasX (unnamed aggregation substance X) based on our evaluation of the family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAQ32636.1	1.41e-287	1	512	1	516
QOL35041.1	1.79e-195	1	512	1	487
QTL77826.1	3.71e-195	1	512	1	478
QTL79729.1	4.44e-194	1	512	1	479
AHJ20247.1	3.15e-191	1	512	1	487

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6M6N7	2.44e-11	38	288	42	293	Resuscitation-promoting factor Rpf2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=rpf2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.531097	0.054856	0.407276	0.000279	0.000226	0.006270

TMHMM  Annotations     

start	end
20	37