CAZyme Information: MGYG000003383_01001

Basic Information

• Species: Bifidobacterium scardovii
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium scardovii
• CAZyme ID: MGYG000003383_01001
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000003383_16|CGC3	40680.3	4.1766

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003383	3123324	MAG	United States	North America

• Gene Location: Start: 215092; End: 216228 Strand: -

Full Sequence      

MIHHNKNKPPARRLTVLLAMLLAMLTAVSMSTPAMADTGVDNSNWQGCVSGQSIALAGGR
FGISKATEGIGYTDPSADCSIQSAINAGLYTGSYHFARPETGNTATGEADWYISQTRGYI
GQHVMPILDFEPPANTLGQWMVDWAYQWLQRVETAYGVKPMIYLNYNTLWSLDWSLVANA
GYGLWIAYPAYDGAGLFEAGAPPYDVSPWPFAAMWQYSWTATGPSPDANVFYGDADTWAA
YAGGHPATPDGTATTPTPSPSPAPEQQPSPGRPFQAVIEPGDTMSQVAAQFGLWPVDAWS
VPSGDPNRIWPGDVVTYHGDATAQQAQTPATPAVHALVVEAGDTLWSISQQFNIPMSSLY
GYSSGDPNLIYPGETLYY

Enzyme Prediction     

No EC number prediction in MGYG000003383_01001.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	40	221	3.6e-36	0.9661016949152542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06417	GH25_LysA-like	1.41e-36	39	238	3	195	LysA is a cell wall endolysin produced by Lactobacillus fermentum, which degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. The N-terminal glycosyl hydrolase family 25 (GH25) domain of LysA has sequence similarity with other murein hydrolase catalytic domains while the C-terminal domain has sequence similarity with putative bacterial cell wall-binding SH3b domains. This domain family also includes LysL of Lactococcus lactis.
cd00599	GH25_muramidase	3.50e-34	39	218	2	169	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	2.41e-33	40	218	1	172	Glycosyl hydrolases family 25.
cd06412	GH25_CH-type	3.76e-26	39	236	3	197	CH-type (Chalaropsis-type) lysozymes represent one of four functionally-defined classes of peptidoglycan hydrolases (also referred to as endo-N-acetylmuramidases) that cleave bacterial cell wall peptidoglycans. CH-type lysozymes exhibit both lysozyme (acetylmuramidase) and diacetylmuramidase activity. The first member of this family to be described was a muramidase from the fungus Chalaropsis. However, a majority of the CH-type lysozymes are found in bacteriophages and Gram-positive bacteria such as Streptomyces and Clostridium. CH-type lysozymes have a single glycosyl hydrolase family 25 (GH25) domain with an unusual beta/alpha-barrel fold in which the last strand of the barrel is antiparallel to strands beta7 and beta1. Most CH-type lysozymes appear to lack the cell wall-binding domain found in other GH25 muramidases.
cd06524	GH25_YegX-like	1.10e-24	39	233	2	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAQ32099.1	6.91e-116	4	378	3	431
BAQ31559.1	3.32e-108	4	378	3	430
QLE14956.1	1.36e-106	5	378	5	372
BAJ69292.1	1.36e-106	5	378	5	372
VEG42930.1	1.36e-106	5	378	5	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JFX_A	5.85e-14	39	242	7	213	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
6ZMV_A	6.70e-14	36	166	1	137	ChainA, muramidase [Trichobolus zukalii],6ZMV_B Chain B, muramidase [Trichobolus zukalii]
2X8R_A	3.44e-08	39	163	6	137	Thestructure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_B The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_C The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_D The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_E The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_F The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25310	6.64e-13	36	242	77	290	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P00721	2.50e-12	39	218	4	186	N,O-diacetylmuramidase OS=Chalaropsis sp. OX=36534 PE=1 SV=1
D4ANU4	5.14e-09	27	244	20	234	N,O-diacetylmuramidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05911 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000234	0.999123	0.000173	0.000183	0.000143	0.000131

TMHMM  Annotations     

start	end
13	35