CAZyme Information: MGYG000003383_01286

Basic Information

• Species: Bifidobacterium scardovii
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium scardovii
• CAZyme ID: MGYG000003383_01286
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
752	MGYG000003383_17|CGC5	78573.03	4.7989

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003383	3123324	MAG	United States	North America

• Gene Location: Start: 221502; End: 223760 Strand: -

Full Sequence      

MTTGSGTIDRLIASMSFTEKVGQLNQRLLGWRAVGRDAGGRLVATDELKREIDRWGGLGT
LYGLLRADPWSGQHWGNGIRPEERPEAVALVQETVLARGAHGIGTLLSEEAPHGHQALGG
TVLPTNLALGATFDPQAVCEAEAAVAAELAASGVHIALVSGLDIARDPRWGRCEECFGED
PLMAARLCEAIVTGMQGERRATVGKGGVAVVLKHLAAQGEAVGGRNGQSAVVGEHDLREI
HLPPVEAGVRAGAWGFMAAYNDIDSVPCCANPWLLRTYLRGELGFDGVVMADGLAVDRLA
DMAGSIPAAGRAALLAGVDISLWDRGFASLEEYADDEAVAAAVDASLRRVLELKRAFGLL
PADGDTAMTVPDLPADRIARAIAVTHERSREMARESLTLLKGDEALGGIRTLLAGTPAQG
GTVVVSGPFADDFGCFLGDYTAPVPEGERTSVYRELCRRYGADRVRLAPDPGDLPEDVWA
QAAAVVFVCGGTSERSYDSAFDDNGAAKAVPEHGATCGEGVDLSDIGLPWGQDARLEAIA
ARTGAPIVSVAVCGRAHVLTRVMDRSAVVVWAGYAGQYGPQAVADALAGGAALPGRLPVT
LPAYPAAVPVRYNDRQGAAHVYRDADEPVLLPFGFGLGALAGVTVDDMRAAADAGSETLA
VTLAVSAGPSGARGALNLFAHCVGGHRVPRLSMLVGSEYLRLEAGQRREVRMAVPFPSLM
DAGDGMVRVRLTALGRTIDVDVDVDVDVARGR

Enzyme Prediction     

No EC number prediction in MGYG000003383_01286.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	101	322	5.4e-60	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	3.89e-49	81	442	43	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK15098	PRK15098	3.52e-47	8	711	38	722	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	4.49e-36	77	324	37	285	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	1.09e-18	162	637	158	631	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.64e-11	417	638	14	215	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAQ31884.1	0.0	1	752	1	750
QRI56690.1	0.0	1	735	1	736
QUI43928.1	0.0	1	735	1	736
BAJ71451.1	0.0	1	735	1	736
AUD81249.1	0.0	1	735	1	736

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	2.33e-53	8	714	14	712	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.08e-52	8	714	14	712	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5Z9S_A	1.11e-47	85	637	71	661	Functionaland Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]
5TF0_A	1.70e-45	8	714	13	711	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	1.60e-44	8	710	7	689	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	4.59e-44	11	719	41	730	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	7.00e-42	8	719	38	730	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	4.36e-40	86	637	48	602	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
A7LXU3	1.56e-35	58	637	81	657	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
T2KMH9	7.28e-32	8	729	40	730	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003383_01286.