CAZyme Information: MGYG000003383_02412

Basic Information

• Species: Bifidobacterium scardovii
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium scardovii
• CAZyme ID: MGYG000003383_02412
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
896	MGYG000003383_34|CGC2	99757.78	4.5199

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003383	3123324	MAG	United States	North America

• Gene Location: Start: 53215; End: 55905 Strand: +

Full Sequence      

MTHTPNTFTSLTEGWTVRALNPQVAPEPLRDAIADGIPATVPGEVTLDLLNAGLIDEPFD
GDNENRQQWIGDVDWQFETTFEWHADGKPRHDLVAYGLDTVATVQLNDQFVGFAQNYHRS
YRWDARGQLRDGLNTLTVTFASSVRESDRREQELGYYPHTEHHAFNQLRKPSYQFGWDWG
IDVANAGMWREIGIDSWSGVRLAAVRPLVSVLGDGTTGVLTTTVEIEREGEGRVMTSADA
HTQQKPTPVSVTLTGHGTDVTVEGEVEYGRNTATIITVVPNAQLWWPLGYGDQPLYDVTV
KAGGESVPAEDGVWSGRVGFRTVHVDTRADEVGRPFQIYVNGVPVHARGYNWVPIDAFLS
RGDKAFYAARFADLVESNSNMVRAWGGSIYESDEFYDLADELGVMVWQDFMLACAAYPED
SATKAEIEAEAREHITRLSSHPSLTVWNGSNENYVAYSEWGGFKQALRDDDKPANEYGYG
EKGWGDYYYADLFPKLLAELDPTHVYLPSSPMSFTKFVDANKDVDGTMHIWDVWNRVDYR
TYADYTPRFADEFGYQAPPAFSTLTRVVHDEQLEPFGKQMLVHQKAMGGNYKLARGMRSH
LTPGDIDDVSYNADGTRNWLIPTDNWDSIEDWHWACQLQQAHAMRFGVEHMRSLEPINAG
ALIWQLNDDWPVVSWAAVDYYGHRKPMWYASRDFFAPRLATIQPRVSDKAREDKSWEGKR
VAADHLALVVLNDTREGWNGSWTVERRTLAGDVLATQTFDVMLGPVDHAELALDAAVAGF
GDPNGEIIVATPSDAAFARAVYNGAEVIDQQLDRAPLAASATAVDGGYELTVTAKAYARD
VFCMVDKVDQDARISGGMVTLLPGESVTWRIASGAAVDPAAFAAANVLRCANDLKR

Enzyme Prediction     

No EC number prediction in MGYG000003383_02412.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	6	777	7.5e-85	0.6981382978723404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	6.32e-68	8	758	12	692	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	7.82e-07	242	533	208	466	beta-D-glucuronidase; Provisional
pfam17753	Ig_mannosidase	5.70e-06	814	868	1	53	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAQ30237.1	0.0	1	896	42	937
QOL32714.1	0.0	1	895	1	889
AHJ18886.1	0.0	2	895	6	894
AUD82655.1	0.0	2	895	6	894
AEF27548.1	0.0	2	896	6	895

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	2.79e-109	7	877	4	838	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	2.85e-109	7	877	4	838	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	1.96e-108	7	877	2	836	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	2.00e-108	7	877	4	838	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	2.95e-106	37	865	26	810	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B7W2	3.26e-78	11	865	9	820	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q2TXB7	8.05e-77	41	868	32	824	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
Q4WAH4	8.18e-77	41	716	32	667	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	2.92e-76	41	716	32	667	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
A1CGA8	2.92e-76	41	716	32	667	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003383_02412.