CAZyme Information: MGYG000003387_01628

Basic Information

• Species: Pseudomonas_R sp900766265
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_R; Pseudomonas_R sp900766265
• CAZyme ID: MGYG000003387_01628
• CAZy Family: GH13
• CAZyme Description: Maltooligosyl trehalose synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
930	MGYG000003387_9|CGC1	104192.69	5.1501

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003387	4465621	MAG	United States	North America

• Gene Location: Start: 111043; End: 113835 Strand: +

Full Sequence      

MIKALSATLRLQFHRDFTLDDATALVDYFDQLGISHVYASPLLTARPGSMHGYDVTDPTR
INPELGGEEALHRLVEALRAKGMGLILDIVSNHMAVGGSGNAWWLDVLEWGRRSPYAQFF
DIQWNSPDPLLEGQLLIPFLGVDYGEALQQGLIPLRVEADTGSLYAEHYEHRFPITPLSY
GEVLRGCEALKPLAQHFDALKTDPAPYQTARQLRADLAEQLKDPSIRQCLEEALALYDST
TEQGFKRLHSLLERQSYRLASWRTAADDINWRRFFDINELGGLRVERPVVFEETHAKIFE
LVADGLVDGLRIDHIDGLANPRGYCRRLRRRVDRLNASRPAEAAEDHVPIYVEKILADGE
KLQDDWGVDGTTGYEFMNQVSLVQHDPAGHAPLCELWRETSGRTDDFMEEVRAARELVLT
GTLAGDFETVAQALLQVARSDLMTRDITLGAIRRALLELIVHFPVYRTYISAAGRREADE
PFFQQALEGARTTLPEADWPLLDHLERWLGGEDLRSVPRGAARNARRYACTRFQQLTSPA
AAKAVEDTSCYRSAVLLSRNDVGFDPQHFSGTVEAFHQACLARQQHFPRNLLTTATHDHK
RGEDTRTRIAVISERAPWFAAKVGQWRDQASAWRKELDDGPAPSPADEMMLFQTLLGSWE
PTLQPDDAEGMEAYCKRILQWQEKAVREAKLRSTWGAPNEAYESACREYTQALLLGDAGA
ALRRDIAAAAAELAPAGVLNSLTQTLLRMTTPGVPDLYQGADYWDFSLVDPDNRRPVDFA
ARRASFSLDADPAELLANWRDARIKQWLIARTLKARREDPDLFTKGRYLPLKVGGAQAER
LIAFAREWEGRWLVVVAARLAYPLLDGADQPRISPENWGDTWVELPEALDGVSLTGLFAR
SAVTPTRVSLGVAQALDSLPMAIYQTTASI

Enzyme Prediction     

No EC number prediction in MGYG000003387_01628.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	26	382	1.8e-127	0.9898648648648649

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3280	TreY	0.0	6	923	5	885	Maltooligosyltrehalose synthase [Carbohydrate transport and metabolism].
cd11336	AmyAc_MTSase	0.0	7	818	1	659	Alpha amylase catalytic domain found in maltooligosyl trehalose synthase (MTSase). Maltooligosyl trehalose synthase (MTSase) domain. MTSase and maltooligosyl trehalose trehalohydrolase (MTHase) work together to produce trehalose. MTSase is responsible for converting the alpha-1,4-glucosidic linkage to an alpha,alpha-1,1-glucosidic linkage at the reducing end of the maltooligosaccharide through an intramolecular transglucosylation reaction, while MTHase hydrolyzes the penultimate alpha-1,4 linkage of the reducing end, resulting in the release of trehalose. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
PRK14507	PRK14507	0.0	7	925	745	1689	malto-oligosyltrehalose synthase.
TIGR02401	trehalose_TreY	0.0	6	923	2	822	malto-oligosyltrehalose synthase. This enzyme, formally named (1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase, is the TreY enzyme of the TreYZ pathway of trehalose biosynthesis, an alternative to the OtsAB pathway. Trehalose may be incorporated into more complex compounds but is best known as compatible solute. It is one of the most effective osmoprotectants, and unlike the various betaines does not require nitrogen for its synthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK14511	PRK14511	0.0	3	923	3	874	malto-oligosyltrehalose synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGZ31025.1	0.0	2	929	1	930
AFN77996.1	0.0	2	927	1	928
AHL75667.1	0.0	2	929	1	930
VEF15900.1	0.0	2	927	1	927
QXY90688.1	0.0	2	929	1	930

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LCV_A	4.95e-126	6	902	3	739	structureof Mutant S44P of maltooligosyltrehalose synthase from Arthrobacter ramosus [Arthrobacter ramosus]
6LCU_A	7.32e-125	6	902	3	739	structureof maltooligosyltrehalose synthase from Arthrobacter ramosus [Arthrobacter ramosus]
5ZCR_A	2.36e-96	8	845	5	678	DSM5389glycosyltrehalose synthase [Saccharolobus shibatae B12],5ZCR_B DSM5389 glycosyltrehalose synthase [Saccharolobus shibatae B12]
1IV8_A	6.77e-78	5	833	2	660	CrystalStructure of Maltooligosyl trehalose synthase [Sulfolobus acidocaldarius]
3HJE_A	8.82e-77	26	833	21	648	Crystalstructure of sulfolobus tokodaii hypothetical maltooligosyl trehalose synthase [Sulfurisphaera tokodaii str. 7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q44315	1.75e-129	7	896	6	745	Maltooligosyl trehalose synthase OS=Arthrobacter sp. (strain Q36) OX=104027 GN=treY PE=1 SV=1
P9WQ21	1.07e-121	17	905	22	747	Putative maltooligosyl trehalose synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=treY PE=1 SV=1
P9WQ20	1.07e-121	17	905	22	747	Putative maltooligosyl trehalose synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=treY PE=3 SV=1
Q8A1G3	3.50e-11	19	135	82	192	Alpha-amylase SusG OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susG PE=1 SV=1
Q08341	1.92e-09	26	123	180	272	Cyclomaltodextrinase OS=Lysinibacillus sphaericus OX=1421 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003387_01628.