CAZyme Information: MGYG000003388_00017

Basic Information

• Species: Neisseria subflava_C
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Neisseriaceae; Neisseria; Neisseria subflava_C
• CAZyme ID: MGYG000003388_00017
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421	MGYG000003388_1|CGC1	47203.75	8.5485

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003388	2136685	MAG	United States	North America

• Gene Location: Start: 14875; End: 16140 Strand: +

Full Sequence      

MQQRIITLLCMAGMAISAHTQAASLKIRPNAPQRYVVKNGDTLWGISGKYLYSPWQWNRL
WGANRNAIRNPHLIYPGQVLVLRYVNGQPRLGFEHAQTRSDGIPVIKLHPRVRETSGYGI
PTVNVNLYRMFMKHPQIIAPEETANAPRLIAGPDNRVLYTQGNRVYAYGLTEPGRYLTYR
VNKNITDPETGKFLGQEVVFSGIANTLPYTDSALENRTRASDEKLKSNEYYTQVNKVMKL
RTQSAQPLVIEEAVSEIRKDDYLLKLPEGLDSFNVMPHAPARPIQAKVVSIFDGVGEAGQ
FQTITLDKGELDGLDKGTVVSLYKRGRQVRVNLSNNLIRKPKDKDTVELVSIPAEEIGLA
MVYRTSDHLASAIILESLNSVSIGDTASEPGRDLDNMADEKTMDKPAEDEQEREIELEVR
S

Enzyme Prediction     

No EC number prediction in MGYG000003388_00017.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11198	PRK11198	1.61e-09	31	82	94	145	LysM domain/BON superfamily protein; Provisional
cd00118	LysM	2.09e-09	33	82	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
COG1652	XkdP	3.69e-09	12	82	190	261	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].
NF033163	lipo_LipL71	5.35e-08	29	91	401	468	lipoprotein LipL71. Members of this family are lipoprotein LipL71, also known as LruA, as described in Leptospira interrogans but found broadly in the genus Leptospira. Close homologs that are not lipoproteins by sequence are likely defective in their reported coding region.
pfam01476	LysM	1.14e-07	35	82	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKI22825.1	8.87e-306	1	421	1	421
QXW93981.1	1.26e-305	1	421	1	421
QXW90741.1	1.26e-305	1	421	1	421
QCL71585.1	1.26e-305	1	421	1	421
QCL69668.1	3.15e-294	1	421	1	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6VE2_O	1.19e-56	1	390	1	341	ChainO, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_P Chain P, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_Q Chain Q, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_R Chain R, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_S Chain S, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_T Chain T, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_U Chain U, LysM domain-containing protein [Pseudomonas aeruginosa PAO1]
3JC8_Ta	9.51e-18	28	387	73	399	ChainTa, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tb Chain Tb, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tc Chain Tc, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Td Chain Td, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Te Chain Te, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tf Chain Tf, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tg Chain Tg, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Th Chain Th, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Ti Chain Ti, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tj Chain Tj, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tk Chain Tk, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tl Chain Tl, LysM domain protein [Myxococcus xanthus DK 1622],3JC9_Ta Chain Ta, TsaP [Myxococcus xanthus DK 1622],3JC9_Tb Chain Tb, TsaP [Myxococcus xanthus DK 1622],3JC9_Tc Chain Tc, TsaP [Myxococcus xanthus DK 1622],3JC9_Td Chain Td, TsaP [Myxococcus xanthus DK 1622],3JC9_Te Chain Te, TsaP [Myxococcus xanthus DK 1622],3JC9_Tf Chain Tf, TsaP [Myxococcus xanthus DK 1622],3JC9_Tg Chain Tg, TsaP [Myxococcus xanthus DK 1622],3JC9_Th Chain Th, TsaP [Myxococcus xanthus DK 1622],3JC9_Ti Chain Ti, TsaP [Myxococcus xanthus DK 1622],3JC9_Tj Chain Tj, TsaP [Myxococcus xanthus DK 1622],3JC9_Tk Chain Tk, TsaP [Myxococcus xanthus DK 1622],3JC9_Tl Chain Tl, TsaP [Myxococcus xanthus DK 1622]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000269	0.999052	0.000170	0.000186	0.000156	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003388_00017.