CAZyme Information: MGYG000003388_00286

Basic Information

• Species: Neisseria subflava_C
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Neisseriaceae; Neisseria; Neisseria subflava_C
• CAZyme ID: MGYG000003388_00286
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
702	MGYG000003388_5|CGC1	76036.19	10.0852

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003388	2136685	MAG	United States	North America

• Gene Location: Start: 73586; End: 75694 Strand: -

Full Sequence      

MAKLKTIALTVSSLSAVSATAYAQNATPNQVGMAMMRLNSALLDQAKAQTFGSGSLWASL
RKDFRINEVNTELVRRHENKFAANSAYFDRTISRSKPYMYHIANEVKKRNMPAEIALLPF
IESAFVTKAKSHVGASGLWQFMPATGRHFGLEKTPLYDGRHDVYAATDAALNYLQYLHGM
FGDWSLALAAYNWGEGNVGRAVNRARAQGLEPTYENLRMPNETRNYVPKLLAVRNIVANP
QTFGMNISEISNQPYFKSVSIDKPIDNSTIARFANISESELLALNPGFNAPVFIPKNNRR
LLLPVSAVSAFEKNYRNANPDTLMSWDIYTSLGNKKLNAIANDTGMSVAELKRLNGLSGS
AISEGRSILVAKNSVTQSQDIINFIDKDNTPDTYQSNMPAMSPIIASSVAEPVKVAQTTV
TNIVAPVVPQSSKPVDFIARSKTENVTSVAVTETKAQPQVASAEVAAPIVAMTHITAEPA
ATNVAEAPKAAIPADLTAPTVAANDVAPTPAVESVAVAPVQEEHDDLMALVQSQPAEEPA
ATVAEATSEAKQVQTVVTAESARTARIAANTAKQQQRINARLARVNGQQNTQTAALAAGT
HRVEDGDTLFNISKRYNLSVADLIIANNIKGNNIRKGQILRVTATPAKVRSNPVQNVSYT
VRKGDTLNTIASRFNVDINDIRRWNRNTRTVSPGQRLKLIGS

Enzyme Prediction     

No EC number prediction in MGYG000003388_00286.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	98	239	4.8e-25	0.9185185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10783	mltD	7.91e-76	12	395	18	406	membrane-bound lytic murein transglycosylase D; Provisional
cd16894	MltD-like	4.16e-62	106	233	1	127	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	6.23e-26	102	209	2	110	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	1.90e-21	122	232	11	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10783	mltD	4.90e-21	582	699	327	446	membrane-bound lytic murein transglycosylase D; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCL70997.1	0.0	1	702	1	702
QXW90061.1	0.0	1	702	1	702
QXW94648.1	0.0	1	702	1	702
QKI22231.1	0.0	1	702	1	702
QCL68919.1	0.0	1	702	1	702

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1E0G_A	5.34e-08	656	700	2	46	LYSMDomain from E.coli MLTD [Escherichia coli]
6FBT_A	1.62e-06	102	232	453	587	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	1.66e-06	102	232	482	616	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FC4_A	3.70e-06	102	232	454	588	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	3.70e-06	102	232	453	587	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	7.66e-59	54	377	57	391	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	7.66e-59	54	377	57	391	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P32820	6.63e-31	93	262	20	186	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
Q49UX4	6.91e-11	591	702	19	132	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
Q5HRU2	9.01e-11	593	701	21	129	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000379	0.998894	0.000175	0.000195	0.000179	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003388_00286.