CAZyme Information: MGYG000003388_00533

Basic Information

• Species: Neisseria subflava_C
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Neisseriaceae; Neisseria; Neisseria subflava_C
• CAZyme ID: MGYG000003388_00533
• CAZy Family: GH87
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
822	MGYG000003388_5|CGC4	88031.48	4.3797

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003388	2136685	MAG	United States	North America

• Gene Location: Start: 330988; End: 333456 Strand: +

Full Sequence      

MVNIKTAVPNASQYGAKLGYTTYEAEQSELKNGVVKNASSSEAERATAREASGQAYVDLP
TNASVSFIAQADANAVTIRYTVPDGESGKVEVKVNNTVIGTLDLSSKSNWQYLDNYTYHP
NDDIKVHDTPAADRLARFQFDEVSQLFKEANIKVGDKVTITNIDSTPVGIDLVDLEKAPD
AIRQPENSVSITDFGAVANDGSDDYQAFIAAIESAKASKKSVYIPEGQFDFSRPISLYVP
DGIKITGAGQWHTKLHFLNTEAAKYDDKGYASGGGGITFEPGSKDIDLGNLSMDSNLNSR
HDEKANYKGISGTLGTGSSIHDIKIEHFEAGVWIGDYSKNKPLNYTDGLTISNATIRNNF
ADGVNFAQGTSNSTVINSNIRGNGDDGLATWSSHHENTNAHVAENNHFLNNTVELGWRAA
GIGIFGGKGHEVANNLIKDNANWGGVRLNTVFKNSHNFDFNDTGISVHDNLLVNNGTNAD
TYGRVKGSIDLEEGRDYATPEKDILGELNNIKIENNTIVNNLSDQEITKTRNPKEGNIPE
PVNETTLTIENNHSLSVAENTSAKNVAEIDDHSLTQAANHLGADNIITITDSSHALVSGG
DGNDRIRGGLGNDTINGDSGNDIIFGYDGNDRLNGGMGNDSIHGGNGNDTLWGESGNDRL
NGGDGNDVLFGGQGTDYLVGGKGADTYVFSLGEGKDTITDNVGEHNALQFGQNISVNDLH
IDAITDVRGNIDWKITVKGSEGDSITINDQFVSGNTNNAVIDTFRFDEGTLSLQELMGRL
SGNDNISNLSDVNTHTNRMSYSSVDTVDVHDDTASTANAGII

Enzyme Prediction     

No EC number prediction in MGYG000003388_00533.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH87	12	578	6.2e-121	0.8358458961474037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033943	RTX_toxin	4.52e-21	615	762	671	815	RTX family hemolysin. RTX family toxin are secreted from the bacteria and inserted into the membranes of infected cells, causing host cell rupture.
cd14490	CBM6-CBM35-CBM36_like_1	1.83e-20	15	175	1	156	uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.
NF033203	entero_EhxA	6.50e-20	599	719	725	862	enterohemolysin EhxA. Members of this family are the RTX toxin called enterohemolysin or EhxA, because it is found in enterohemorrhagic Escherichia coli (EHEC) strains such as O157:H7.
COG2931	COG2931	2.23e-13	578	733	287	458	Ca2+-binding protein, RTX toxin-related [Secondary metabolites biosynthesis, transport and catabolism].
NF035945	Zn_serralysin	2.91e-11	588	700	257	380	serralysin family metalloprotease.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKI22002.1	0.0	1	822	1	811
QMT37009.1	1.09e-240	5	809	3	838
ARC49812.1	5.23e-157	10	529	135	625
ARC23745.1	3.22e-156	10	529	135	625
CCB95088.1	3.29e-156	14	529	140	626

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZRU_A	1.40e-100	12	496	10	482	ChainA, Alpha-1,3-glucanase [Niallia circulans],5ZRU_C Chain C, Alpha-1,3-glucanase [Niallia circulans]
7C7D_A	1.33e-35	15	476	54	461	Crystalstructure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus],7C7D_B Crystal structure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus]
6K0M_A	3.84e-22	15	472	14	434	Catalyticdomain of GH87 alpha-1,3-glucanase from Paenibacillus glycanilyticus FH11 [Paenibacillus glycanilyticus],6K0N_A Catalytic domain of GH87 alpha-1,3-glucanase in complex with nigerose [Paenibacillus glycanilyticus]
6K0S_A	3.67e-21	15	472	14	434	Catalyticdomain of GH87 alpha-1,3-glucanase D1069A in complex with nigerose [Paenibacillus glycanilyticus],6K0V_A Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_B Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_C Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_D Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q37893	9.55e-06	189	448	104	333	Pre-neck appendage protein OS=Bacillus phage B103 OX=10778 GN=12 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998825	0.001148	0.000037	0.000007	0.000003	0.000018

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003388_00533.