CAZyme Information: MGYG000003388_00629

Basic Information

• Species: Neisseria subflava_C
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Neisseriaceae; Neisseria; Neisseria subflava_C
• CAZyme ID: MGYG000003388_00629
• CAZy Family: GH77
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1428		162387.06	4.7481

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003388	2136685	MAG	United States	North America

• Gene Location: Start: 57289; End: 61575 Strand: -

Full Sequence      

MSETLEQQAVQAGIDLGYHDINGTYRVTKTEVLESIVAVLDKSKPDSDGLYLNTMVAHEN
GEESLQMPSEFHGAEAVVLIDEADECQTLTLYLGDNDTLWIKLPQLACGYYTLSAETGGK
CRLVRLIVAPESVYQPKLLANGGRMNGLTMHLYSLRSERNWGIGDFTDLLNLMKYAAEKK
LDFVGINPLHALFTSKPAFASPYSPSSREWLNPIYLDIEKVGAFTYNEQLKNWLAQPKIR
QRIAALRITETVTYTAVWACKRDALQMAFNAFEQDTCEAAENERAAFESFVMEKGKALQG
FGLFEALDQYYSRPGQVGWQSWPSEFHQPDGEAVEKFERSHEREIRFYMWLQWLCAEQLQ
EVNQAAAEYGVKLGIYGDLAVGVARGSADTWLNRQDYCMDVSVGAPPDPLGPTGQNWDLP
PLNPSMLKHTGYEKFAHLLRENMRLYGVLRIDHVMALCRLWWVLKDKTADFGAYVHYDAE
VTFAILALESQRNRCVIIGEDLGTVPDQARYLLNRYQVFSYKVMYFSKGWNGFQLPDEYP
EQAITVISTHDVAPLAGYWIGKDLDTMFKLGTLPDAAAFQTALDEREHDKADLLDKLKET
GCLGADVQMPAKADETLLAALHKYGALSRSKLYAVQLENLLGVIDNLNVPGVTEGYPNWA
QKMPVSLEDFLQHRLMGGQLAIIDEVRMKTNSQIKAYHELDQIERDTVESLFLATHSDVF
AYLGRHRLAEGDEVVRVLIPGAVSVDIVNRRSGELIVPSEKIDERGFFVAVLPDDAPDYA
LRIRYTEDTEPVIEEDPYHFSSALQDMDSWLLAEGKHLRPYETLGAHFAELDGVKGVRFA
VWAPNAQRVSVIGEFNNWDGRRHVMRFHRDNGIWDIFIPAVKLNALYKFEIRDANGNVRE
KADPYAFGAELRPTTASIVRGLPDEVEEPAFRARANAIDAPISIYEVHLGSWKRNPENNF
WLTYEELAKELVAYVKDMGFTHIEFLPVSEYPFDGSWGYQATGLYAPTSRFGSPEELRAL
IKAAHDEGISVILDWVVGHFPTDDHGLAKFDGTALYEHADPREGYHQDWNTLIYNFGRNE
VKNFLQGNALYWIERFGFDGIRVDAVASMIYRNYSRKDGEWIPNQYGGHENLEAIAFLRD
TNTMLKEEVPAATEIAEESTSFANVTRQEGLNFSFKWNMGWMNDTLRYMMEDPINRKYHH
NKMTFGMMYQYSENFVLPLSHDEVVHGKRSLLGRMPGDCWQQFANLRAYYGFMYGFPGKK
LLFMGSEFAQGREWNYNEGLDWFLLEQEGGWHKGVQDFVRELNHVYKDTAPLYQLDQWPE
GFEWLVADDGDNSVFVFERRDREGNRVIVISNFTPVVREGYRFGVNSAGEYREILNSDDL
PYKGSGVSAGATVETEEVWSHSKPNSLSVTVPPLATVYLYQAAVKEEA

Enzyme Prediction     

No EC number prediction in MGYG000003388_00629.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	974	1270	6.3e-152	0.9933554817275747
GH77	150	681	2.1e-146	0.9817813765182186
CBM48	823	907	3e-19	0.881578947368421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	801	1419	4	625	1,4-alpha-glucan branching protein GlgB.
PRK14706	PRK14706	0.0	812	1424	15	624	glycogen branching enzyme; Provisional
PRK14705	PRK14705	0.0	702	1423	502	1224	glycogen branching enzyme; Provisional
PRK14507	PRK14507	0.0	1	687	4	721	malto-oligosyltrehalose synthase.
COG0296	GlgB	0.0	804	1420	6	627	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKI21631.1	0.0	1	1428	1	1428
QCL68344.1	0.0	1	1428	1	1428
QXW91384.1	0.0	1	1428	1	1428
QXW95286.1	0.0	1	1428	1	1428
AVR78910.1	0.0	1	1423	1	1421

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1M7X_A	7.75e-307	811	1423	1	616	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
4LPC_A	2.33e-304	817	1423	2	611	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
5GQW_A	1.86e-233	698	1419	20	771	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	2.87e-232	698	1419	20	771	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQZ_A	5.70e-232	698	1419	20	771	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0TC27	0.0	701	1423	3	727	1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) OX=362663 GN=glgB PE=3 SV=1
Q65TI0	0.0	703	1419	5	725	1,4-alpha-glucan branching enzyme GlgB OS=Mannheimia succiniciproducens (strain MBEL55E) OX=221988 GN=glgB PE=3 SV=1
Q4QK67	0.0	703	1419	5	725	1,4-alpha-glucan branching enzyme GlgB OS=Haemophilus influenzae (strain 86-028NP) OX=281310 GN=glgB PE=3 SV=1
Q1R5J4	0.0	701	1423	3	727	1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli (strain UTI89 / UPEC) OX=364106 GN=glgB PE=3 SV=1
Q6CZK0	0.0	706	1423	6	725	1,4-alpha-glucan branching enzyme GlgB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003388_00629.