CAZyme Information: MGYG000003388_01315

Basic Information

• Species: Neisseria subflava_C
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Neisseriaceae; Neisseria; Neisseria subflava_C
• CAZyme ID: MGYG000003388_01315
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
233	MGYG000003388_13|CGC1	26593.66	10.0837

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003388	2136685	MAG	United States	North America

• Gene Location: Start: 15467; End: 16168 Strand: +

Full Sequence      

MFRIIKWLIALPIGIFIFFNAYVYGNIITYRAVAPSKTAFMSMRMSQFAKEGRDVKLDYR
WVPYDQISVNLKKALIASEDANFAEHSGFDWNGIKYAMKRNKQSGEVKAGGSTISQQLAK
NLFLNESRSYIRKGEEAAITAMMEAVTDKDRIFELYLNSIEWHYGVFGAEAASQYFYKKP
ASALTRQQAAKLTARVPAPLFYADHPKSKRMHNKTNIILRRMGSAELPESDMD

Enzyme Prediction     

No EC number prediction in MGYG000003388_01315.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	58	222	1e-55	0.9265536723163842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	1.54e-110	1	229	1	230	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	1.34e-90	6	228	1	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	8.85e-74	1	226	17	244	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	8.13e-62	60	222	14	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	5.57e-41	1	222	1	230	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXW91124.1	2.50e-165	1	233	1	233
QXW95546.1	2.50e-165	1	233	1	233
QCL71220.1	2.50e-165	1	233	1	233
QKI23226.1	1.44e-164	1	233	1	233
QCL68053.1	1.09e-159	1	233	1	233

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	3.02e-29	61	222	22	183	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	4.24e-29	61	222	22	183	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
4OON_A	2.94e-23	45	222	31	202	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5FGZ_A	1.53e-21	61	232	158	333	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	1.54e-21	61	232	179	354	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1KVS7	2.69e-145	1	233	1	233	Biosynthetic peptidoglycan transglycosylase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) OX=272831 GN=mtgA PE=3 SV=1
A9M2N3	1.55e-144	1	233	1	233	Biosynthetic peptidoglycan transglycosylase OS=Neisseria meningitidis serogroup C (strain 053442) OX=374833 GN=mtgA PE=3 SV=1
P0A0Z3	6.32e-144	1	233	1	233	Biosynthetic peptidoglycan transglycosylase OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mtgA PE=3 SV=1
Q51005	8.98e-144	1	233	1	233	Biosynthetic peptidoglycan transglycosylase OS=Neisseria gonorrhoeae OX=485 GN=mtgA PE=3 SV=1
Q5F6F6	8.98e-144	1	233	1	233	Biosynthetic peptidoglycan transglycosylase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999984	0.000015	0.000005	0.000000	0.000000	0.000011

TMHMM  Annotations     

start	end
7	29