CAZyme Information: MGYG000003388_01589

Basic Information

• Species: Neisseria subflava_C
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Neisseriaceae; Neisseria; Neisseria subflava_C
• CAZyme ID: MGYG000003388_01589
• CAZy Family: GT107
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
704	MGYG000003388_13|CGC6	79442.75	8.5537

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003388	2136685	MAG	United States	North America

• Gene Location: Start: 291186; End: 293300 Strand: +

Full Sequence      

MFLFSDGLQSINNNNRRKRIVKNAYIPSRGIRKIPHLSTLLPEFHICKDGKGAETVVGWG
LRPTTHKARAFAAEHQLPFIALEDGFLRSLGLGVAGYPPYSIVYDDIGIYYDTTRPSRLE
QLILAADTMPSETLAQAQQAMDFILQHHLSKYNHAPELSDDHPLHSPSKPETILIIDQTF
GDMAIQYGGADASTFELMFQTALNENPQADIWVKTHPDVLCGKKQGYLTQLAQQHRAHLL
AEDINPISLLQNVDKVYCVTSQMGFEALLCGKPLTTFGLPWYAGWGVSDDRHPQIGSLVQ
TQRRARRNLLQLFAAAYLQYSRYLNPNTGEAGSLFDVIDYLATVKRKNDKLRGELYCVGM
SLWKRAVAKPFFNVPSCRLKFISSTQKLAGVKLSDDARILAWGNGKEAIVRFAEQHNIPL
LRMEDGFIRSVGLGSNLVPPLSLVTDDMGIYFNAETPSRLEHILQNQNFDDQDFQTALKL
QKMLTENHISKYNVGSSDFTVPSTNKTVILVPGQVEDDASIRYGSPQIYRNLDLLRTVRE
RNPDAYIIYKPHPDVVSGNRIGHISPEDTARYADQTVEQADILTCLQYADEIHTMTSLTG
FESLLRGKKVSCYGLPFYAGWGLTQDLLPIPRRSRRLELWQLIAGTLIHYPDYIHPETHQ
AINAETAAQILIRQKNMQKNNNGLHRGYFAKKLGKIKQLYRSFK

Enzyme Prediction     

No EC number prediction in MGYG000003388_01589.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT107	323	698	2.1e-146	0.7011278195488722
GT107	17	347	1.9e-106	0.5921052631578947

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3563	KpsC	0.0	21	704	1	671	Capsule polysaccharide export protein KpsC/LpsZ [Cell wall/membrane/envelope biogenesis].
cd16440	beta_Kdo_transferase_KpsC_1	3.51e-163	56	326	1	262	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat1. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16439	beta_Kdo_transferase_KpsC_2	1.07e-161	397	653	1	259	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat 2. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	2.93e-104	399	653	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	2.29e-100	56	323	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADZ00638.1	0.0	1	704	1	704
AEQ62020.1	0.0	1	704	1	704
CCP19724.1	0.0	1	704	1	704
AEQ62079.1	0.0	1	704	1	704
CCP19935.1	0.0	1	704	1	704

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MGC_A	1.33e-99	26	376	5	353	Escherichiacoli KpsC, N-terminal domain [Escherichia coli APEC O1]
6MGB_A	9.42e-86	31	341	19	321	Thermosulfurimonasdismutans KpsC, beta Kdo 2,4 transferase [Thermosulfurimonas dismutans]
6MGD_A	1.39e-82	354	680	3	324	Thermosulfurimonasdismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans],6MGD_B Thermosulfurimonas dismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P57037	0.0	1	704	1	704	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=lipA PE=4 SV=1
Q05013	0.0	1	704	1	704	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lipA PE=4 SV=2
P42217	2.80e-203	26	673	4	643	Capsule polysaccharide export protein KpsC OS=Escherichia coli OX=562 GN=kpsC PE=4 SV=1
P31858	8.20e-59	359	676	80	404	Lipopolysaccharide-processing protein LpsZ OS=Rhizobium meliloti OX=382 GN=lpsZ PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003388_01589.