CAZyme Information: MGYG000003390_00552

Basic Information

• Species: Pseudescherichia vulneris
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pseudescherichia; Pseudescherichia vulneris
• CAZyme ID: MGYG000003390_00552
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335	MGYG000003390_7|CGC2	37721.77	8.9497

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003390	4956281	MAG	United States	North America

• Gene Location: Start: 57433; End: 58440 Strand: -

Full Sequence      

MNLTRVKRVVAATVVLVGLLSASFAQASTAWDTYKSRFLMPDGRIVDTGNKNVSHTEGQG
FAMLMAVANDDRASFDKMWAWTEKTLKNKENGLFYWRYNPVEPDPIPDKNDATDGDALIA
WALLKADARWHDGRYGAASDAITKALVSHTVINFAGYRVMLPGAKGFNLNSYVNLNPSYF
IFPAWQAFADRSHLTVWRDLIRDAKTLTGKMGWGEANLPTDWVALAADGKMQPAKEWPPR
MSYDAIRIPLYIAWQDPNSALLTPWRSWWQKFSRSQTPAWVNVTTNEAAPYNMNEGQLAV
RDLTLGTKNGEPQITAQDDYYSASLKMLSWLAEQR

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	29	332	2.2e-82	0.990625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	6.53e-100	30	334	7	320	Glycosyl hydrolases family 8.
COG3405	BcsZ	1.05e-52	15	253	10	252	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	6.40e-37	8	335	1	355	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCU57497.1	7.02e-206	6	334	2	330
BAY00708.1	1.43e-199	1	335	1	335
AUV03660.1	5.21e-199	7	335	3	331
AKL14625.1	1.44e-198	7	335	3	331
QOV68643.1	1.49e-198	7	335	3	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5CZL_A	2.20e-175	25	333	26	334	ChainA, Glucanase [Raoultella ornithinolytica]
5GY3_A	1.14e-168	29	334	2	307	ChainA, Glucanase [Klebsiella pneumoniae]
6VC5_A	1.92e-69	31	335	8	315	1.6Angstrom Resolution Crystal Structure of endoglucanase from Komagataeibacter sucrofermentans [Komagataeibacter sucrofermentans]
1WZZ_A	7.00e-67	31	332	23	327	Structureof endo-beta-1,4-glucanase CMCax from Acetobacter xylinum [Komagataeibacter xylinus]
3QXQ_A	8.75e-24	30	260	6	241	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P18336	2.25e-156	8	306	4	302	Endoglucanase OS=Cellulomonas uda OX=1714 PE=1 SV=1
P27032	1.33e-134	25	332	21	329	Minor endoglucanase Y OS=Dickeya dadantii (strain 3937) OX=198628 GN=celY PE=1 SV=1
P37696	9.74e-69	31	332	31	335	Probable endoglucanase OS=Komagataeibacter hansenii OX=436 GN=cmcAX PE=1 SV=1
Q8Z289	9.08e-25	14	262	9	265	Endoglucanase OS=Salmonella typhi OX=90370 GN=bcsZ PE=3 SV=1
Q8ZLB7	3.26e-24	19	262	14	265	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000256	0.999040	0.000198	0.000182	0.000168	0.000150

TMHMM  Annotations     

start	end
9	31