CAZyme Information: MGYG000003391_00028

Basic Information

• Species: Gemella sp900766305
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Gemellaceae; Gemella; Gemella sp900766305
• CAZyme ID: MGYG000003391_00028
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331	MGYG000003391_3|CGC1	38766.41	8.5181

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003391	2000366	MAG	United States	North America

• Gene Location: Start: 2319; End: 3314 Strand: -

Full Sequence      

MKYFLKETYVKANHAGPKARMDAEKIMLDNGYQEYYLTDNQKNNDLNEDDVIILQFPLLW
KSLKMQIRMKFLKRKNFRAYLLIHDIESLRNKKIKTFKDFKHSIIYYLQNKTVLERVDGI
IAHNDKMRSEIMKMGIKPEKIVTLEVFDYLIPDLDDNKSYDKDKILLAGNFDIRKTKYAR
NLPEKPEFEIYGINFEHDNLPNNVHYNGSFSPDELPNHLQGGFGLVWDGDSSDTCSGKYG
EYLKINNPHKASLYLASNFPIIVWSQSALADFVRNTDCGITIDSLNEIAGALESMNEERY
RQLIENRRKIGEKIRQGHYLKTALEKCERKL

Enzyme Prediction     

No EC number prediction in MGYG000003391_00028.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	10	328	6.6e-102	0.9813664596273292

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	1.64e-93	1	331	1	333	sugar transferase.
cd03794	GT4_WbuB-like	4.40e-14	50	309	100	375	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
cd03809	GT4_MtfB-like	9.06e-08	71	225	96	284	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALD68124.1	1.80e-170	1	331	1	331
QKL33121.1	2.97e-169	1	331	1	331
ARC46701.1	1.62e-95	1	326	1	348
AGY39025.1	1.26e-94	1	325	1	347
AGU82419.1	1.44e-93	1	328	1	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QKW_A	2.21e-15	46	324	64	322	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	2.34e-15	46	324	72	330	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	1.30e-46	3	325	2	321	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
B3XPQ7	1.07e-15	46	324	62	325	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
F8KEJ1	5.18e-15	46	331	67	337	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1
B5A7L9	1.19e-14	46	324	62	320	Glucosyltransferase 3 OS=Streptococcus parasanguinis OX=1318 GN=gtf3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000011	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003391_00028.