CAZyme Information: MGYG000003392_00550

Basic Information

• Species: Streptococcus mitis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus mitis
• CAZyme ID: MGYG000003392_00550
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
536		62982.09	7.1258

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003392	1810665	MAG	United States	North America

• Gene Location: Start: 6334; End: 7944 Strand: +

Full Sequence      

MSVPFFIREERLKTKIGKIGLASAFLLGLIVNQVAANEAEVKASSEESSVQASSSKVEEK
KSETTTSQKEEEKKVETSSSQRPEKKEEVKETRASSQKEESKPNSTSAHWEGDFYVKADG
SKAKSEWIFDTSYNSWFYIKADGRYAQKEWHGNYYLKAGGYMAKNEWVYDNNYKSWFYLK
ADGSYAEQEWQKINGKWYYFKKWGYMAKSQWQGNYFLNGQGVMMQNEWLYDNHYKSWFYL
KADGSYANEQWQKIDGKWYYFKKWGYMAQDEWHGNYYLTESGVMATGELIMDDTRYTFAD
SGELKEKKALNVGWVYRNGHRYFFNHREEQVGTDRAKKVIDVSEHNGRISDWKKVIQENG
VDGVIVRLGYSGVEDKELAYNIQELNRLGIPYGVYLYTYAENETDAENDAKQTIELLKKY
KMNLSYPIYYDVENWEYENKSKKAPTDTTTWVKIINKYMETMKHAGYQNVKVYSYRQLLQ
TRLNHPNILQHVNWVAAYTDALDWNNPHYSGEKGWQYTSSDSLKGIRGHVDVSVWY

Enzyme Prediction     

EC	3.2.1.17

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	340	526	1.5e-33	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	7.65e-61	337	536	1	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	2.76e-33	338	535	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
COG5263	COG5263	6.55e-27	90	305	79	295	Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].
NF033930	pneumo_PspA	8.28e-23	136	319	452	638	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	6.56e-21	40	319	361	661	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGS42675.1	6.50e-288	1	536	1	536
QBZ12157.1	6.50e-288	1	536	1	536
QBZ13927.1	1.12e-281	1	536	1	536
CBJ22803.1	5.41e-261	1	536	1	536
BBP10229.1	7.58e-251	12	536	1	524

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WW5_A	4.61e-196	105	536	37	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	1.31e-195	105	536	37	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P59205	1.87e-12	110	322	28	219	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=lytB PE=1 SV=1
P59206	1.96e-12	110	322	28	219	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=lytB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.050961	0.946281	0.002006	0.000262	0.000231	0.000238

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003392_00550.