CAZyme Information: MGYG000003393_00071

Basic Information

• Species: Pantoea ananatis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pantoea; Pantoea ananatis
• CAZyme ID: MGYG000003393_00071
• CAZy Family: GH38
• CAZyme Description: Mannosylglycerate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
877	MGYG000003393_3|CGC1	100486.84	6.1002

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003393	4793768	MAG	United States	North America

• Gene Location: Start: 13923; End: 16556 Strand: +

Full Sequence      

MKKRTVHLYTHTHWDQEWYFTSSRSRIYLYNHIKNLIQVLETHPEFPCYLLDAQSSLIES
YLQWAPEDRARLTKLIADERLLTGPWFTQTDQLVIHQESVVRNLFYGMEVAQRHGNVMKL
GYVPDCFGQGGNMPQLYRQFGIHHALFWRGIADNTLHETEFFWQGDNGDRVFALQMPWGY
HYGGLLDETPETMKAFLDEKMAAIEARSHRQHLLFPHGFDQAPVRRNLPELVEQFNARDD
SREYLISNPLTVVKMLEQEAGAEARTLKGELTEAKHSRVHKTIFSCRADLKLLNNEVESL
LVNTLEPVLAISQSLGNAYPKHIVATIWKLMFYNAAHDSIGGCNSDDTNQDVFFRYKEAK
GLAQNLLELHTRLITQRIPRQHDFTFTAFNPLPWSVAPDITFEAWLPGLPFTLRDGNGKA
IPCVIESEEDLTQYVLNQTIRLDPGKAWHKPEKVCRTRLTVNSPVLPALGYDRWYIDFSE
DNAARPALSQETTAENDVYHIQAEADGLLTITDKRSGKRYPRQMLFVENGDDGDSYNYSP
PRADWMITSEGTMTTVQKQKSTVSQGLILRYALKVPADLAERAAGTATTTLNLKVKVVLQ
NDDLIRFNVEVDNNVLSHRLCVHFATDIAARVSCADQLFGAVTRPVQLGKALQCWEEERW
QEKPISIEPMQSYVNLHDEQHGFTLHTNGVREYEIVGDDFNTLSLTLFRTFGFMGKENLL
YRPGRASGESIVETPDAQLLKTMTFSFGWRTYLGTFDEAQHARVSKTWLTEFPVYQDSDF
LNGRLRFCLNDEVRDYPETYSALSLPATHRDALVSAVKCAEDHSGIIIRFYNPHLETDVV
IPPLQDARCVMLDEMTPMQARQTLKPNDVQTVLIKRI

Enzyme Prediction     

No EC number prediction in MGYG000003393_00071.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH38	5	261	5.3e-61	0.9442379182156134

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09819	PRK09819	0.0	1	875	1	875	mannosylglycerate hydrolase.
cd10815	GH38N_AMII_EcMngB_like	2.29e-149	5	275	1	270	N-terminal catalytic domain of Escherichia coli alpha-mannosidase MngB and its bacterial homologs; glycoside hydrolase family 38 (GH38). The bacterial subfamily is represented by Escherichia coli alpha-mannosidase MngB, which is encoded by the mngB gene (previously called ybgG). MngB exhibits alpha-mannosidase activity that converts 2-O-(6-phospho-alpha-mannosyl)-D-glycerate to mannose-6-phosphate and glycerate in the pathway which enables use of mannosyl-D-glycerate as a sole carbon source. A divalent metal ion is required for its activity.
COG0383	AMS1	6.78e-118	1	875	1	940	Alpha-mannosidase [Carbohydrate transport and metabolism].
cd10814	GH38N_AMII_SpGH38_like	4.02e-75	5	275	1	271	N-terminal catalytic domain of SPGH38, a putative alpha-mannosidase of Streptococcus pyogenes, and its prokaryotic homologs; glycoside hydrolase family 38 (GH38). The subfamily is represented by SpGH38 of Streptococcus pyogenes, which has been assigned as a putative alpha-mannosidase, and is encoded by ORF spy1604. SpGH38 appears to exist as an elongated dimer and display alpha-1,3 mannosidase activity. It is active on disaccharides and some aryl glycosides. SpGH38 can also effectively deglycosylate human N-glycans in vitro. A divalent metal ion, such as a zinc ion, is required for its activity. SpGH38 is inhibited by swainsonine. The absence of any secretion signal peptide suggests that SpGH38 may be intracellular.
cd10790	GH38N_AMII_1	9.28e-64	6	272	2	270	N-terminal catalytic domain of putative prokaryotic class II alpha-mannosidases; glycoside hydrolase family 38 (GH38). This mainly bacterial subfamily corresponds to a group of putative class II alpha-mannosidases, including various proteins assigned as alpha-mannosidases, Streptococcus pyogenes (SpGH38) encoded by ORF spy1604. Escherichia coli MngB encoded by the mngB/ybgG gene, and Thermotoga maritime TMM, and similar proteins. SpGH38 targets alpha-1,3 mannosidic linkages. SpGH38 appears to exist as an elongated dimer and display alpha-1,3 mannosidase activity. It is active on disaccharides and some aryl glycosides. SpGH38 can also effectively deglycosylate human N-glycans in vitro. MngB exhibits alpha-mannosidase activity that catalyzes the conversion of 2-O-(6-phospho-alpha-mannosyl)-D-glycerate to mannose-6-phosphate and glycerate in the pathway which enables use of mannosyl-D-glycerate as a sole carbon source. TMM is a homodimeric enzyme that hydrolyzes p-nitrophenyl-alpha-D-mannopyranoside, alpha -1,2-mannobiose, alpha -1,3-mannobiose, alpha -1,4-mannobiose, and alpha -1,6-mannobiose. The GH38 family contains retaining glycosyl hydrolases that employ a two-step mechanism involving the formation of a covalent glycosyl enzyme complex. Two carboxylic acids positioned within the active site act in concert: one as a catalytic nucleophile and the other as a general acid/base catalyst. Divalent metal ions, such as zinc or cobalt ions, are suggested to be required for the catalytic activities of typical class II alpha-mannosidases. However, TMM requires the cobalt or cadmium for its activity. The cadmium ion dependency is unique to TMM. Moreover, TMM is inhibited by swainsonine but not 1-deoxymannojirimycin, which is in agreement with the features of cytosolic alpha-mannosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AER32219.1	0.0	1	877	1	877
AMB76236.1	0.0	1	877	1	877
QAB29990.1	0.0	1	877	1	877
AVG77391.1	0.0	1	877	1	877
ADD77509.1	0.0	1	877	32	908

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KBP_A	9.67e-89	1	767	4	804	Thecrystal structure of an alpha-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583],5KBP_B The crystal structure of an alpha-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583]
3LVT_A	1.18e-85	3	767	6	804	TheCrystal Structure of a Protein in the Glycosyl Hydrolase Family 38 from Enterococcus faecalis to 2.55A [Enterococcus faecalis V583]
2WYH_A	1.58e-75	1	764	23	826	Structureof the Streptococcus pyogenes family GH38 alpha-mannosidase [Streptococcus pyogenes M1 GAS],2WYH_B Structure of the Streptococcus pyogenes family GH38 alpha-mannosidase [Streptococcus pyogenes M1 GAS],2WYI_A Structure of the Streptococcus pyogenes family GH38 alpha-mannosidase complexed with swainsonine [Streptococcus pyogenes M1 GAS],2WYI_B Structure of the Streptococcus pyogenes family GH38 alpha-mannosidase complexed with swainsonine [Streptococcus pyogenes M1 GAS]
5JM0_A	1.52e-08	13	408	311	707	Structureof the S. cerevisiae alpha-mannosidase 1 [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54746	6.08e-162	6	833	7	822	Mannosylglycerate hydrolase OS=Escherichia coli (strain K12) OX=83333 GN=mngB PE=1 SV=2
Q9KER1	4.64e-67	3	854	2	871	Putative mannosylglycerate hydrolase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=mngB PE=3 SV=2
P22855	8.28e-08	13	408	298	694	Alpha-mannosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AMS1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003393_00071.