CAZyme Information: MGYG000003393_01627

Basic Information

• Species: Pantoea ananatis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pantoea; Pantoea ananatis
• CAZyme ID: MGYG000003393_01627
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
579		64862.92	9.6439

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003393	4793768	MAG	United States	North America

• Gene Location: Start: 161308; End: 163047 Strand: +

Full Sequence      

MVNTKNCQSVFPVTRATGPERFLLRKFASKSNTHAYATMPFLPAPQQISLVLCVLVFICW
LLPGLFGHEPWKPDEAYTFGLIRHIAQTGDWVVPTLAGEPFMEKPPLYFIVASFFLRLFS
PLLGEPDAARMATGFFIVLACYAIALSARELFGKGAGRWAVLILFACLGFPVRAHQMITD
IALLAGGATGIYGFILGIRRHVLGGAILGIGAAVMFLSKGLLGPGILGLTALTLPLMNTA
FRSRRYIVFCAIAFLVFCPLVVPWLYALWMRSEKLFSTWLLVNNFGRFDGTAKLGPKAKH
FFYFKLLPWYAFPALPMAAWWLWRSWKTGISASAMVLVTFFLAGFVTLSSASDARELYAM
PLLLPLAILAAGTCQQKTLWTIKLRPWTLGLFCLLPTVMWGAGIILMTGWPAPLWNKWVA
QGAPGFTPQISSVMFAAALLATLLLSGLVFLNRTCRESPLSIFTSCITLCWVLAMTLGMP
YLDYTKRYSDVFLPLRAWLPRDECVASRHLGEPQRALLEYYDGLVTLREGKHRGAYRCNW
LLLQHDKRHPEEFVDGTLVWQGERPADNEENYQLYRLNR

Enzyme Prediction     

No EC number prediction in MGYG000003393_01627.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	47	522	3.1e-55	0.8666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	4.94e-26	49	530	9	476	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	1.45e-10	104	264	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UAC69887.1	3.91e-55	52	575	63	621
ACB74694.1	9.00e-15	42	206	5	172
QDU20239.1	4.01e-13	47	180	31	161
AWI08836.1	1.19e-12	55	199	113	254
AVL27167.1	3.19e-12	54	493	21	458

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8GDR9	1.07e-08	49	405	9	372	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Serratia proteamaculans (strain 568) OX=399741 GN=arnT PE=3 SV=1
Q4ZSZ0	2.76e-06	50	377	9	335	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=arnT PE=3 SV=1
C5BDQ8	3.64e-06	55	378	12	336	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
A1JPM4	8.38e-06	51	377	11	340	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999597	0.000413	0.000001	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
48	67
129	148
155	172
176	198
205	227
247	269
301	323
328	350
388	410
430	452
459	481