CAZyme Information: MGYG000003393_04027

Basic Information

• Species: Pantoea ananatis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pantoea; Pantoea ananatis
• CAZyme ID: MGYG000003393_04027
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
791	MGYG000003393_33|CGC1	86257	5.2663

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003393	4793768	MAG	United States	North America

• Gene Location: Start: 163235; End: 165610 Strand: +

Full Sequence      

MTAIYKDPHRPVAERVADLLPRMTAEEKFAQMHAYWLILDEEGNHQERTDLSDEFTGVSA
QTALKERLTRGIGQITRPLGTHIVDALTGVRAANRLQRDVTEGSRLGIPALLHEECLVGL
LCKGATLFPSSLNYGSTWDPELIRRAAQRIGTEARSVGCKQGLAPVLDVSRDVRWGRTEE
TFGEDPWLVGVMATAYVEGLQGDTRDLLATLKHYVGHSFSEGARNHAPVHLGFSELNDIF
LLPFEMAVKLANAGSVMPAYHDIDNQPGHSDRFLLTEVLREQWGFDGIVVADYGGVSLLH
QHHGVAQDAAESAALAFNAGLDVELPKDDCARHLADAVSRNLLSMEKVDEIVGRILTEKF
RLGLFEQPYINEETISLQDEETRQVAREVATRSITLLENNGILPLQQASRVAVVGPCADD
PLALLSGYSFPVHLIISDMLEETSQVTTPLAALCHTLGQQNVSYAKGCHIIEKRAAGAPV
FPGDSGAKPVQQSPVSQDTHLIAEAVRVAQESDVVVACVGDLAGLFQSGTVGEGSDTDSM
NLPGVQQLLLEALVDTGKPVIVVMTGGRPYNLQGLENKVAAFLLAWAPGQEGGWAIADIL
TGRAEPQGRLVVSVPKNVGAMPFYYNHKLKSGGTPIAFHFGARYPFGYGLSGTTFSWGTL
QSEQDSVAIDGEIRLRMTLTNSGQRQGSEVVQLYIRDKVASMVRPLQELKAFQRVTLQPG
ETAELCFTLPVDMLNFTRRDGKRIVEPGEFELQVGSSCRDIHGVSTVTVRGETRVLPCHW
RMLSDCKVNII

Enzyme Prediction     

EC	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	102	326	2.8e-64	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.08e-158	16	755	38	751	beta-glucosidase BglX.
COG1472	BglX	1.32e-83	23	421	1	367	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.04e-73	24	357	1	315	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	2.47e-63	105	755	78	769	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.52e-52	394	651	1	215	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCF09621.1	0.0	1	791	1	791
QTC44482.1	0.0	1	791	1	791
AER32664.1	0.0	1	791	1	791
ASN15209.1	0.0	1	791	1	791
ADD77120.1	0.0	1	791	1	791

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	6.75e-138	5	761	36	777	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	1.28e-129	19	761	17	744	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	6.98e-129	19	761	17	744	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5Z9S_A	3.13e-125	2	759	14	776	Functionaland Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]
5YOT_A	2.93e-119	5	770	7	757	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	8.93e-126	51	759	11	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	2.16e-113	16	756	38	752	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	2.41e-111	16	755	38	751	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH9	4.20e-109	5	760	29	746	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
Q23892	1.33e-80	82	756	143	813	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003393_04027.