CAZyme Information: MGYG000003393_04150

Basic Information

• Species: Pantoea ananatis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pantoea; Pantoea ananatis
• CAZyme ID: MGYG000003393_04150
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
443	MGYG000003393_34|CGC2	48436.79	5.8378

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003393	4793768	MAG	United States	North America

• Gene Location: Start: 113432; End: 114763 Strand: +

Full Sequence      

MHLSLGDFHPVADGETPDTRILQQAIDQIAAAGGGRLTLPPGRYRSGCLNLPSDFELHLE
AGAVLVASRHLADYQQWKALSCAEKSHNVLLYALGQRNLTITGQGHIEGDAEAWFAAEPD
EQGYRVPKADRPRMIVFEDCEQVRLQDISLIRAPMWTVHLVSCRHVHIERLTIDNAMTLP
NTDALDIDSCEAVFNSNSYFSAADDAICIKTTFKPAGLRRPARRIAVSNCLLRSDSCALK
IGTETWDDIEDITVSGCTLFDSNRGIGIVSRDGGAIRRVLFSTIAFSCHHVAACHWGKAD
PIFISVRTRDPAVLPGIVEQVQFSQLSGVAEGAINLHAAQPGWIRDISLNQLHLRQTVAQ
GVQGQYDVRPPCNPDSPTGMGLDNAYRLDKTTGEAYGVERYPGGLPGLFARGVENLQLNN
LTIQRPEPLPSGWHPDSVVLLAD

Enzyme Prediction     

No EC number prediction in MGYG000003393_04150.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	29	359	4.7e-60	0.9230769230769231

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	2.13e-57	3	281	83	390	Polygalacturonase [Carbohydrate transport and metabolism].
PLN02793	PLN02793	1.00e-15	3	274	53	313	Probable polygalacturonase
pfam00295	Glyco_hydro_28	7.22e-15	98	287	52	237	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN03003	PLN03003	1.49e-13	3	286	24	288	Probable polygalacturonase At3g15720
PLN02218	PLN02218	4.88e-09	3	373	68	431	polygalacturonase ADPG

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASN16862.1	0.0	1	443	1	443
QAB32139.1	0.0	1	443	1	443
AVG75336.1	0.0	1	443	1	443
AER34437.1	0.0	1	443	1	443
BAK13562.1	0.0	1	443	1	443

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OLP_A	3.70e-24	7	285	49	356	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
3JUR_A	8.10e-22	3	281	28	343	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
4MXN_A	9.92e-20	12	231	31	236	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]
2UVE_A	6.43e-14	3	281	157	482	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
2PYG_A	1.02e-07	1	115	1	122	Azotobactervinelandii Mannuronan C-5 epimerase AlgE4 A-module [Azotobacter vinelandii],2PYG_B Azotobacter vinelandii Mannuronan C-5 epimerase AlgE4 A-module [Azotobacter vinelandii],2PYH_A Azotobacter vinelandii Mannuronan C-5 epimerase AlgE4 A-module complexed with mannuronan trisaccharide [Azotobacter vinelandii],2PYH_B Azotobacter vinelandii Mannuronan C-5 epimerase AlgE4 A-module complexed with mannuronan trisaccharide [Azotobacter vinelandii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	2.92e-25	4	339	64	427	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
Q94AJ5	5.33e-18	3	361	53	401	Probable polygalacturonase At1g80170 OS=Arabidopsis thaliana OX=3702 GN=At1g80170 PE=1 SV=1
P27644	4.70e-13	123	312	12	213	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
Q9LW07	1.08e-12	3	284	24	286	Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana OX=3702 GN=At3g15720 PE=3 SV=1
P15922	5.44e-10	3	285	152	479	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000012	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003393_04150.