CAZyme Information: MGYG000003393_04412

Basic Information

• Species: Pantoea ananatis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pantoea; Pantoea ananatis
• CAZyme ID: MGYG000003393_04412
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
155		17338.07	9.4001

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003393	4793768	MAG	United States	North America

• Gene Location: Start: 7832; End: 8299 Strand: -

Full Sequence      

MSQIIAILNFEEGYAEMPYLDSLGFPTVAGGIRIGPKGASLSNYVLRVPRRVGDVWKQCI
LENKITDMQSRAPLKQALAKCNDARTDVLMSMAYQLGVDGVLQFKNMLSAITREHFTEAG
DAMLNSLWARQTPGRVRRHAEVMRSGNYDIYRGLL

Enzyme Prediction     

No EC number prediction in MGYG000003393_04412.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00735	T4-like_lys	2.00e-55	3	149	1	145	bacteriophage T4-like lysozymes. Bacteriophage T4-like lysozymes hydrolyze the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls. Members include a variety of bacteriophages (T4, RB49, RB69, Aeh1), as well as Dictyostelium.
PHA02596	5	8.84e-26	4	151	175	336	baseplate hub subunit and tail lysozyme; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAB31525.1	4.01e-110	1	155	1	155
ASN16292.1	4.01e-110	1	155	1	155
CCF10803.1	4.01e-110	1	155	1	155
BAK10310.1	4.01e-110	1	155	1	155
ADD76063.1	4.01e-110	1	155	1	155

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1T8G_A	4.14e-12	4	154	3	164	ChainA, Lysozyme [Tequatrovirus T4]
1L62_A	4.14e-12	4	154	3	164	ChainA, LYSOZYME [Tequatrovirus T4]
1PQM_A	1.13e-11	4	154	3	164	ChainA, Lysozyme [Tequatrovirus T4]
1PQK_A	1.13e-11	4	154	3	164	ChainA, Lysozyme [Tequatrovirus T4],1PQK_B Chain B, Lysozyme [Tequatrovirus T4],1PQK_C Chain C, Lysozyme [Tequatrovirus T4]
1G0L_A	1.13e-11	4	154	3	164	ChainA, PROTEIN (LYSOZYME) [Tequatrovirus T4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q556F2	1.34e-10	1	152	2	170	Probable T4-type lysozyme 1 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274831 PE=3 SV=1
P16009	9.17e-10	7	151	179	339	Pre-baseplate central spike protein Gp5 OS=Enterobacteria phage T4 OX=10665 GN=5 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003393_04412.