CAZyme Information: MGYG000003394_00776

Basic Information

• Species: Haemophilus influenzae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus; Haemophilus influenzae
• CAZyme ID: MGYG000003394_00776
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
180		19834.17	9.3718

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003394	1902954	MAG	United States	North America

• Gene Location: Start: 24874; End: 25416 Strand: -

Full Sequence      

MILTKTRKALGVCSVITVMGLMYAQFGGELRLSPVGAEIIGNAEGCRRDPYQCPADVLTV
GIGSTEYGGKKINPKHRYTDLEIAERWKNDIVIAERCVNKYGNGEMLPQSVFDSAVSITF
NVGCGAVSKSTMFKYLRAKQYEKACGEFPRWVYASGKKLAGLVVRREKEKALCLADLKLP

Enzyme Prediction     

No EC number prediction in MGYG000003394_00776.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	33	169	8.6e-40	0.9854014598540146

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16901	lyz_P1	4.87e-76	31	174	1	140	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd00737	lyz_endolysin_autolysin	2.06e-44	36	174	1	136	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	1.30e-41	31	177	6	151	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
pfam00959	Phage_lysozyme	1.06e-28	57	167	1	107	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.
cd16900	endolysin_R21-like	1.76e-28	39	174	11	142	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIT67280.1	1.69e-130	1	180	1	180
AXP64514.1	1.69e-130	1	180	1	180
AXP62806.1	1.69e-130	1	180	1	180
AXP77495.1	1.69e-130	1	180	1	180
BBE84046.1	1.69e-130	1	180	1	180

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XJU_A	5.62e-37	31	177	1	154	ChainA, Lysozyme [Punavirus P1],1XJU_B Chain B, Lysozyme [Punavirus P1]
1XJT_A	6.22e-37	28	177	26	182	ChainA, Lysozyme [Punavirus P1]
6ET6_A	1.28e-20	28	174	48	194	ChainA, Lysozyme [Acinetobacter baumannii]
3HDE_A	4.91e-15	27	174	15	161	ChainA, Lysozyme [Enterobacteria phage P21],3HDE_B Chain B, Lysozyme [Enterobacteria phage P21],3HDE_C Chain C, Lysozyme [Enterobacteria phage P21],3HDE_D Chain D, Lysozyme [Enterobacteria phage P21]
3HDF_A	5.61e-15	44	174	10	136	ChainA, Lysozyme [Enterobacteria phage P21],3HDF_B Chain B, Lysozyme [Enterobacteria phage P21]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q37875	1.27e-37	5	177	4	182	SAR-endolysin OS=Escherichia phage P1 OX=2886926 GN=17 PE=1 SV=1
P51728	3.36e-29	3	176	1	186	SAR-endolysin OS=Haemophilus phage HP1 (strain HP1c1) OX=1289570 GN=lys PE=3 SV=1
O80292	7.80e-19	22	174	12	163	SAR-endolysin OS=Bacteriophage PS119 OX=83128 GN=19 PE=3 SV=1
O80288	4.27e-18	44	174	37	163	SAR-endolysin OS=Bacteriophage PS34 OX=83127 GN=19 PE=3 SV=1
Q37896	2.52e-15	30	174	1	143	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.890518	0.107767	0.001103	0.000183	0.000120	0.000319

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003394_00776.