CAZyme Information: MGYG000003394_01830

Basic Information

• Species: Haemophilus influenzae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus; Haemophilus influenzae
• CAZyme ID: MGYG000003394_01830
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
292	MGYG000003394_37|CGC2	33207.22	4.7915

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003394	1902954	MAG	United States	North America

• Gene Location: Start: 63782; End: 64660 Strand: +

Full Sequence      

MKRIYTDEPTNQPTNQPTNQNNKTVAVVTSTIGRPELSLAIKSVQNQTYPCKHYVFVDGN
IFWDKAKSILEQFPDVIPIYLPMNTGKNGILNGAINAVAAFLVEEDIICYLDDDNQLRED
HVESLVNVIEQGADFAYSLRSFYDSNHQFICNDDFDSLGNWNTKSDIFVDVKIEDIQKQI
HFTFNEVNGHIDTNCYAVPREIAQKTSYSWNTPLIGDRSFLSALKSLGLIGQTSGKYTVK
YRADFNKLIAVRRVFPQLSLSDEDNNNISAKILEVINQQNIEYYGGRPWAKE

Enzyme Prediction     

No EC number prediction in MGYG000003394_01830.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	5.76e-10	40	132	16	106	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	1.81e-06	35	142	10	117	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	1.17e-05	21	140	1	115	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam04886	PT	8.62e-05	6	21	11	26	PT repeat. This short repeat is composed on the tetrapeptide XPTX. This repeat is found in a variety of proteins, however it is not clear if these repeats are homologous to each other. The alignment represents nine copies of this repeat.
pfam04886	PT	9.70e-05	6	20	3	17	PT repeat. This short repeat is composed on the tetrapeptide XPTX. This repeat is found in a variety of proteins, however it is not clear if these repeats are homologous to each other. The alignment represents nine copies of this repeat.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBE88258.1	3.08e-209	1	292	1	292
BBE84725.1	6.92e-207	1	292	1	296
BBF03843.1	1.72e-205	1	292	1	288
CBY80902.1	2.42e-204	1	292	1	293
QEQ61349.1	1.14e-203	1	292	1	297

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44171	1.89e-89	161	292	17	148	Uncharacterized protein HI_1386 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1386 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003394_01830.