CAZyme Information: MGYG000003394_01856

Basic Information

• Species: Haemophilus influenzae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus; Haemophilus influenzae
• CAZyme ID: MGYG000003394_01856
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
200	MGYG000003394_37|CGC3	22867.24	9.5741

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003394	1902954	MAG	United States	North America

• Gene Location: Start: 86732; End: 87334 Strand: -

Full Sequence      

MTMMISEVTFNKIFPHAVKGVYQAISAQIEKAGCVNKMQQAMFLAQCGHESGGFTRFKEN
LNYSWLGLSKTFRKYFPDPLIAKKYERKPELIANRVYANRLGNGDEKSGDGWKYRGRGLI
QITGKDNYAAFRKWLGRDIEPDDVAGNLDLSVKTAVWYWKCYELAELNSVEKVTRRINGG
LNGIDERCKLYRALMVTDND

Enzyme Prediction     

No EC number prediction in MGYG000003394_01856.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	31	173	1.3e-34	0.4935064935064935

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3179	COG3179	3.63e-105	2	200	1	206	Predicted chitinase [General function prediction only].
cd00325	chitinase_GH19	6.54e-15	5	181	1	190	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	1.43e-08	36	159	49	154	Chitinase class I.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXP40127.1	3.35e-149	1	200	1	200
AXP46304.1	3.35e-149	1	200	1	200
BBE88231.1	3.35e-149	1	200	1	200
CKH09673.1	3.35e-149	1	200	1	200
AXP65152.1	3.35e-149	1	200	1	200

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OK7_A	2.17e-32	5	193	27	217	ChainA, Endolysin [Salmonella phage SPN1S],4OK7_B Chain B, Endolysin [Salmonella phage SPN1S],4OK7_C Chain C, Endolysin [Salmonella phage SPN1S]
3W3E_A	4.67e-08	37	159	55	157	Structureof Vigna unguiculata chitinase with regulation activity of the plant cell wall [Vigna unguiculata],3W3E_B Structure of Vigna unguiculata chitinase with regulation activity of the plant cell wall [Vigna unguiculata]
2CJL_A	2.23e-07	5	159	3	138	CrystalStructure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]
1DXJ_A	1.02e-06	37	159	54	156	Structureof the chitinase from jack bean [Canavalia ensiformis]
1CNS_A	3.48e-06	35	159	52	158	CrystalStructure Of Chitinase At 1.91a Resolution [Hordeum vulgare],1CNS_B Crystal Structure Of Chitinase At 1.91a Resolution [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44187	7.53e-147	1	200	1	200	Glycosyl hydrolase family 19 domain-containing protein HI_1415 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1415 PE=3 SV=1
O64203	7.26e-17	24	198	202	362	Endolysin A OS=Mycobacterium phage D29 OX=28369 GN=10 PE=1 SV=1
O22842	3.60e-06	19	180	111	247	Endochitinase At2g43610 OS=Arabidopsis thaliana OX=3702 GN=At2g43610 PE=1 SV=1
P29021	5.93e-06	99	159	114	167	Acidic endochitinase OS=Petunia hybrida OX=4102 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999697	0.000328	0.000013	0.000002	0.000001	0.000007

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003394_01856.