CAZyme Information: MGYG000003395_00091

Basic Information

• Species: Superficieibacter sp900766525
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Superficieibacter; Superficieibacter sp900766525
• CAZyme ID: MGYG000003395_00091
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
625	MGYG000003395_4|CGC1	70468	6.0051

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003395	5080781	MAG	United States	North America

• Gene Location: Start: 43432; End: 45309 Strand: +

Full Sequence      

MKLNTVSAIPGTLSFINPGNIQPLGWLKRQLTLQAQGLSGQLKEVWPDVGENSGWLGGSG
ENWERGPYYLDGLLPLAYCLHDEKLIKKTQKWIEWMLNSQDAEGWFGPRQNDDWWPRMVA
LKVLMQYADATSDPRVLPFMQRYFHYQLQHLPERPLSDWGKARAADNVLPVLWAWKQQPD
DDKLPELARLLLAQGNHWPEFILHHLPTGPVNYFSHLTHVVNVAMGMKYSAMHDDINQQR
QRLTEIQRCFSELDRHHGQAQGMFSGDEWLAGNAPEQGVELCAIVELMYSLENLLRIYGE
ASFADRLERIAFNALPAGITADMMAHQYHQQPNQIAVSVAQRNWTYSGDECNTFGLEPNF
GCCTANYHQGWPKLCNSLFMRVGAGDLACMVYAPATVASGDWKVSLDTDYPFNADLIFTV
HSAPAGEKTLWLRIPQWSRGALITLNGNTLPVMNESGYLPLTRQWQTGDNVTVIFEREVI
VEPRHHNAVSLYYGPLLMALTPGEIWEKIPGGAITGDWEVRPRSTWNYALDVQPETGADI
REIHYRPSGEQPFALASAPLTLRASARRLPTWKVVDNSAGPVPNSPAYDAMSCPSTVTLV
PYGCARIRIAEFPWVDGRQKQAEAH

Enzyme Prediction     

No EC number prediction in MGYG000003395_00091.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	257	499	2.5e-28	0.47713717693836977

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.16e-28	68	499	62	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	5.17e-19	280	577	292	575	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJE95537.1	8.24e-125	10	613	37	646
QHS59113.1	1.19e-123	19	613	46	649
QPH39723.1	4.53e-123	19	623	44	656
QNK64903.1	4.64e-123	19	613	40	643
QNN43859.1	1.77e-122	19	620	44	654

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	2.17e-14	280	500	333	561	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	9.25e-14	280	525	381	635	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QK0_A	1.15e-13	280	500	333	561	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5OPJ_A	5.09e-07	357	503	409	564	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6YQH_AAA	5.09e-07	357	503	409	564	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.973657	0.026140	0.000092	0.000056	0.000029	0.000049

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003395_00091.