CAZyme Information: MGYG000003395_00627

Basic Information

• Species: Superficieibacter sp900766525
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Superficieibacter; Superficieibacter sp900766525
• CAZyme ID: MGYG000003395_00627
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
167	MGYG000003395_21|CGC1	18619.35	9.11

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003395	5080781	MAG	United States	North America

• Gene Location: Start: 27858; End: 28361 Strand: -

Full Sequence      

MPMTSSLRNKLIAAAGGGAMLIATAFLGGHDGVEGRKYEAYKDVAGVWTVCDGHTGRDIV
RHKTYTDWECDALLWKDLQPAKRTVDQLVKVPVGEYQRAALYSFVFNVGSDAFSKSALLR
KLNKGDHTGACEEMRRWVYAGGMKWKGLQNRREMERSMCLAEGKNDL

Enzyme Prediction     

No EC number prediction in MGYG000003395_00627.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	31	155	1.4e-43	0.927007299270073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16900	endolysin_R21-like	6.74e-73	16	160	1	142	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd00737	lyz_endolysin_autolysin	3.72e-50	34	160	9	136	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	8.27e-42	13	160	1	148	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd16901	lyz_P1	1.61e-32	18	160	6	140	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
pfam00959	Phage_lysozyme	1.62e-25	47	153	1	107	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFH50447.1	5.98e-111	1	167	1	167
QBF87122.1	5.98e-111	1	167	1	167
AXF62392.1	5.98e-111	1	167	1	167
VTP67831.1	1.21e-110	1	167	1	167
QIG28655.1	1.21e-110	1	167	1	167

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HDE_A	8.19e-59	3	160	1	161	ChainA, Lysozyme [Enterobacteria phage P21],3HDE_B Chain B, Lysozyme [Enterobacteria phage P21],3HDE_C Chain C, Lysozyme [Enterobacteria phage P21],3HDE_D Chain D, Lysozyme [Enterobacteria phage P21]
4ZPU_A	1.60e-58	3	160	1	161	Thestructure of DLP12 endolysin exhibits likely active and inactive conformations. [Escherichia coli K-12],4ZPU_B The structure of DLP12 endolysin exhibits likely active and inactive conformations. [Escherichia coli K-12],4ZPU_C The structure of DLP12 endolysin exhibits likely active and inactive conformations. [Escherichia coli K-12],4ZPU_D The structure of DLP12 endolysin exhibits likely active and inactive conformations. [Escherichia coli K-12]
3HDF_A	2.20e-53	29	160	5	136	ChainA, Lysozyme [Enterobacteria phage P21],3HDF_B Chain B, Lysozyme [Enterobacteria phage P21]
6ET6_A	4.83e-24	34	160	64	194	ChainA, Lysozyme [Acinetobacter baumannii]
2ANV_A	1.67e-15	34	141	16	127	ChainA, Lysozyme [Lederbergvirus P22],2ANV_B Chain B, Lysozyme [Lederbergvirus P22],2ANX_A Chain A, Lysozyme [Lederbergvirus P22],2ANX_B Chain B, Lysozyme [Lederbergvirus P22]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O80292	1.18e-58	1	160	1	163	SAR-endolysin OS=Bacteriophage PS119 OX=83128 GN=19 PE=3 SV=1
P78285	6.36e-58	3	160	1	161	Lysozyme RrrD OS=Escherichia coli (strain K12) OX=83333 GN=rrrD PE=1 SV=1
P10439	3.66e-57	3	160	1	161	SAR-endolysin OS=Enterobacteria phage PA-2 OX=10738 GN=15 PE=3 SV=1
O80288	7.84e-57	1	160	1	163	SAR-endolysin OS=Bacteriophage PS34 OX=83127 GN=19 PE=3 SV=1
P27359	1.04e-56	3	160	1	161	SAR-endolysin OS=Enterobacteria phage P21 OX=10711 GN=R PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.959909	0.036158	0.001246	0.002013	0.000421	0.000261

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003395_00627.