CAZyme Information: MGYG000003395_01820

Basic Information

• Species: Superficieibacter sp900766525
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Superficieibacter; Superficieibacter sp900766525
• CAZyme ID: MGYG000003395_01820
• CAZy Family: GT107
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
673	MGYG000003395_42|CGC2	74514.57	9.1741

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003395	5080781	MAG	United States	North America

• Gene Location: Start: 117193; End: 119214 Strand: +

Full Sequence      

MIGVYSRGIWKIPHLNQLLGRPSYKLSVNGAIPDDISAIAVWGMKDNTTLPAAKAQAADL
PLLRLEDGFIRSLGLGVNGHPPLSIVIDDLGIYYDASRPSRLEKLIQKECRENTFAAEAQ
SAIDLIVSGDLSKYNHALPFTAAAQARPIVLVIDQTHGDVSITLGGATAQTFSNMLTAAC
EENPDAEIWVKTHPDVLSGKKQGHFRDSFSDPSIRLLAQDVSPQSLLRCASRVYTVTSQY
GIEALMAGKPVACFGLPWYAGWGLTDDRHPLAASLAARRGQATLLQLTGAALLRYPRYLN
PNTHKRGTLFDVLHTLQLQRKHMISRSGNLWCPGLTLWKSAIMKTFLKTPENRLNFNKKS
PAATACVVWGVNGEAKFSEAAHAQHLPLWRMEDGFLRSSGLGSDLHMPLSLVLDKTGIYY
DARRASDLETLLSQSALRTDERKRALALQETLVSSKLSKYNLGKRWQRPIDAEGKRLLLV
PGQVENDASIATGTFTIQSNLALLRTVRERNPDAYIVYKPHPDVLAGNRPGHIAADEAAQ
LADCVAMDADIIDCITACDELHTMTSLSGFEALMHGKTVYCYGLPFYAGWGLTHDEHTCP
HRNRTLTLADLIYQTLVVFPTYIHPQNKRVISVEQAAAWLMVQTRPETIARKKAGRITRW
WRKGVNLYRVKFN

Enzyme Prediction     

No EC number prediction in MGYG000003395_01820.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT107	278	661	4.6e-142	0.7218045112781954
GT107	10	321	7.1e-104	0.5902255639097744

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3563	KpsC	0.0	4	662	6	668	Capsule polysaccharide export protein KpsC/LpsZ [Cell wall/membrane/envelope biogenesis].
cd16439	beta_Kdo_transferase_KpsC_2	1.42e-154	367	622	4	259	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat 2. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16440	beta_Kdo_transferase_KpsC_1	5.86e-143	39	301	1	262	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat1. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	1.89e-119	366	622	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	3.26e-106	39	298	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBV67716.1	1.50e-317	1	672	1	672
ADO49976.1	2.72e-302	1	673	1	674
AVG00592.1	6.18e-299	1	672	1	674
QJG38824.1	6.18e-299	1	672	1	674
AWS62685.1	8.77e-299	1	672	1	674

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MGC_A	2.03e-144	2	350	3	352	Escherichiacoli KpsC, N-terminal domain [Escherichia coli APEC O1]
6MGB_A	1.22e-76	2	316	11	321	Thermosulfurimonasdismutans KpsC, beta Kdo 2,4 transferase [Thermosulfurimonas dismutans]
6MGD_A	2.36e-66	336	636	10	314	Thermosulfurimonasdismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans],6MGD_B Thermosulfurimonas dismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42217	7.74e-296	1	672	1	674	Capsule polysaccharide export protein KpsC OS=Escherichia coli OX=562 GN=kpsC PE=4 SV=1
P57037	1.55e-204	6	643	28	674	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=lipA PE=4 SV=1
Q05013	1.77e-203	6	643	28	674	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lipA PE=4 SV=2
P31858	2.19e-51	338	622	96	381	Lipopolysaccharide-processing protein LpsZ OS=Rhizobium meliloti OX=382 GN=lpsZ PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003395_01820.