CAZyme Information: MGYG000003395_02203

Basic Information

• Species: Superficieibacter sp900766525
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Superficieibacter; Superficieibacter sp900766525
• CAZyme ID: MGYG000003395_02203
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
202	MGYG000003395_51|CGC1	23163.36	10.0287

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003395	5080781	MAG	United States	North America

• Gene Location: Start: 9043; End: 9651 Strand: +

Full Sequence      

MWRKGLCVLCTLWVLPACAAQPPRAAQAWRSELIRTAREIWGLNAPVADFAGQFQQESGW
RPDARSPVGAQGMAQFMPATARWMSERYPQLRENAPMNPGWAIRALVQYDRYLWQNTAAQ
DDCQRMAFTLSAYNGGQGWVNRDKRLAATKGLNALIWFDQVERVNAGRSKNNWRENRDYP
KKILYQHAPQYLQWGTSSCTPL

Enzyme Prediction     

No EC number prediction in MGYG000003395_02203.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	50	187	8.1e-19	0.7555555555555555

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	1.13e-24	51	177	16	136	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13399	Slt35-like	1.47e-23	44	149	2	108	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG4623	MltF	9.13e-17	29	193	271	441	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
cd00254	LT-like	2.47e-16	55	184	9	107	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	5.25e-14	57	185	29	142	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASO41850.1	6.17e-114	1	199	1	199
QQI06696.1	6.17e-114	1	199	1	199
QQH93318.1	1.24e-113	1	199	1	199
AGQ71620.1	1.77e-113	1	199	1	199
QBM69204.1	3.56e-113	1	199	1	199

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	9.69e-07	55	188	476	596	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	1.31e-06	55	188	476	596	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1S850	4.37e-10	56	159	305	402	Membrane-bound lytic murein transglycosylase F OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) OX=326297 GN=mltF PE=3 SV=2
B0TLJ6	7.96e-10	56	188	302	421	Membrane-bound lytic murein transglycosylase F OS=Shewanella halifaxensis (strain HAW-EB4) OX=458817 GN=mltF PE=3 SV=1
A3QCH2	1.21e-08	56	177	302	417	Membrane-bound lytic murein transglycosylase F OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) OX=323850 GN=mltF PE=3 SV=1
A8H256	3.00e-08	56	188	302	421	Membrane-bound lytic murein transglycosylase F OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) OX=398579 GN=mltF PE=3 SV=1
B1KLC4	3.00e-08	56	177	303	418	Membrane-bound lytic murein transglycosylase F OS=Shewanella woodyi (strain ATCC 51908 / MS32) OX=392500 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000417	0.432883	0.566140	0.000221	0.000181	0.000158

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003395_02203.