CAZyme Information: MGYG000003395_02713

Basic Information

• Species: Superficieibacter sp900766525
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Superficieibacter; Superficieibacter sp900766525
• CAZyme ID: MGYG000003395_02713
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312	MGYG000003395_56|CGC4	35160.37	8.2397

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003395	5080781	MAG	United States	North America

• Gene Location: Start: 205089; End: 206027 Strand: +

Full Sequence      

MKIALIVPTYCAGKLWSEFWQALEHQTRYPDVIQIIDSGSTDNTVAIAQAHRHVSCTIID
KTDFNHGGTRNLAVSMVEDVDILIFLTQDAILNDATALENILEIFEDKDVAAVCGRQLPH
HDANPIARHARLFNYPSVSSVKTKNDIPSLGIKTVFMSNSFAAYRACVYKEMGGFPLHTI
LAEDMYMAARMIQAGYKVAYCAEAAVRHSHNYTPAEEFKRYFDTGVFHETTSWIQQDFGG
AGGEGVRFVKSEIIYLLKHAPLWLIRAGITTVAKLSGYKLGLRWRSLSLKQCKKLSMYKS
YWNRADLINNQK

Enzyme Prediction     

No EC number prediction in MGYG000003395_02713.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	5	171	1.5e-17	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02525	Succinoglycan_BP_ExoA	1.48e-15	2	225	1	224	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
COG1216	GT2	4.43e-15	1	213	3	224	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06439	CESA_like_1	2.59e-14	2	220	30	240	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
pfam13641	Glyco_tranf_2_3	2.29e-13	3	220	4	223	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
pfam00535	Glycos_transf_2	6.70e-12	6	165	3	160	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQJ86922.1	4.84e-145	1	311	1	311
AKW10795.1	9.75e-145	1	311	1	311
AGS62540.1	9.75e-145	1	311	1	311
CDS66125.1	9.75e-145	1	311	1	311
AET53216.1	9.75e-145	1	311	1	311

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26403	3.93e-145	1	311	1	311	O antigen biosynthesis rhamnosyltransferase RfbN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003395_02713.