CAZyme Information: MGYG000003395_02876

Basic Information

• Species: Superficieibacter sp900766525
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Superficieibacter; Superficieibacter sp900766525
• CAZyme ID: MGYG000003395_02876
• CAZy Family: GH13
• CAZyme Description: Maltooligosyl trehalose synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
842		94557.63	4.7565

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003395	5080781	MAG	United States	North America

• Gene Location: Start: 27476; End: 30004 Strand: -

Full Sequence      

MSIPTSTYRIQFRNGMTFDRAAALVPYLQRFGISHLYASPIFTATADSTHGYDVTNAGEI
EPSIGGREGFDRLVSALKSAGLGLILDIVPNHMAASLENPWWRDVVEYGENSRYARHFDV
DWSRRLTLPFLGDTFEEAAVKGEISIKRDPQTLKPALAYYDSLYPLTPQSWQGREEAILA
LSDPRDIAKLHDEQHYQLTCWREAADILSYRRFFEITGLVGVRVEDKTVFDDTHRLILDL
VHSGAVDGLRVDHVDGLADPKAYLDRLREEAGAECYITVEKILGKGEHLPEEWPISGTTG
YEFIAALSDVLVDDSNIAALRQAYDRVVGEPVDLKAELRDAKLLMVDRNFAGEFTTLLKL
AVALAGAENAALEEEAIRGALRELLVAFPVYRTYGTQDGLTPADDALLQRVIARIRMDAH
APHPEALNFLRRILSGDLSQDASADAATFRTRFQQLTGPLMAKSVEDTLFFRQNMDLALN
EVGAEPLPRTFSIHRFHSEMQTRLERQPDAISSTSTHDTKRGEDARARLYALTEAPERWA
ECVERWRGLNQHKVALLDDGPAPRATGAWMLFQALAGVWPPTLQPQDEVELKALEERFVV
FVEKALREAKLRTDWGDSNEAYEKAVLDYTRHLLSPDNQAFLQDFTDALQPFIRAGLINS
LTQAVVKLAAPGVPDIYQGSETLNFSLVDPDNRREPDFVELERLLAEDEPFAAPTEESWR
SGQLKQHVTARLLHLRQEKPALFREGAYLPLEATGIREENVLAFARADDDDALIVITPRL
AFDEHHDSLVHHARWADTAITLPERLTGQRWRNLLSGEGVDLNDRINLAAFEGGVCILLI
RE

Enzyme Prediction     

No EC number prediction in MGYG000003395_02876.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	25	309	3.3e-117	0.9898648648648649

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14511	PRK14511	0.0	1	820	2	856	malto-oligosyltrehalose synthase.
COG3280	TreY	0.0	1	842	1	889	Maltooligosyltrehalose synthase [Carbohydrate transport and metabolism].
PRK14507	PRK14507	0.0	3	821	742	1668	malto-oligosyltrehalose synthase.
TIGR02401	trehalose_TreY	0.0	4	821	1	805	malto-oligosyltrehalose synthase. This enzyme, formally named (1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase, is the TreY enzyme of the TreYZ pathway of trehalose biosynthesis, an alternative to the OtsAB pathway. Trehalose may be incorporated into more complex compounds but is best known as compatible solute. It is one of the most effective osmoprotectants, and unlike the various betaines does not require nitrogen for its synthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd11336	AmyAc_MTSase	0.0	6	738	1	659	Alpha amylase catalytic domain found in maltooligosyl trehalose synthase (MTSase). Maltooligosyl trehalose synthase (MTSase) domain. MTSase and maltooligosyl trehalose trehalohydrolase (MTHase) work together to produce trehalose. MTSase is responsible for converting the alpha-1,4-glucosidic linkage to an alpha,alpha-1,1-glucosidic linkage at the reducing end of the maltooligosaccharide through an intramolecular transglucosylation reaction, while MTHase hydrolyzes the penultimate alpha-1,4 linkage of the reducing end, resulting in the release of trehalose. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUY24352.1	0.0	1	840	1	842
AIX74651.1	0.0	1	840	1	842
QNU44407.1	0.0	1	840	1	842
ARJ43335.1	0.0	1	840	1	842
AUX92542.1	0.0	1	840	1	842

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LCU_A	1.93e-132	3	812	1	737	structureof maltooligosyltrehalose synthase from Arthrobacter ramosus [Arthrobacter ramosus]
6LCV_A	3.80e-132	3	812	1	737	structureof Mutant S44P of maltooligosyltrehalose synthase from Arthrobacter ramosus [Arthrobacter ramosus]
5ZCR_A	5.76e-106	7	705	5	626	DSM5389glycosyltrehalose synthase [Saccharolobus shibatae B12],5ZCR_B DSM5389 glycosyltrehalose synthase [Saccharolobus shibatae B12]
3HJE_A	3.02e-98	6	768	5	659	Crystalstructure of sulfolobus tokodaii hypothetical maltooligosyl trehalose synthase [Sulfurisphaera tokodaii str. 7]
1IV8_A	2.48e-94	5	766	3	669	CrystalStructure of Maltooligosyl trehalose synthase [Sulfolobus acidocaldarius]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q44315	6.53e-140	1	808	1	745	Maltooligosyl trehalose synthase OS=Arthrobacter sp. (strain Q36) OX=104027 GN=treY PE=1 SV=1
P9WQ20	1.23e-127	1	817	1	739	Putative maltooligosyl trehalose synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=treY PE=3 SV=1
P9WQ21	1.23e-127	1	817	1	739	Putative maltooligosyl trehalose synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=treY PE=1 SV=1
P07191	6.40e-09	27	106	61	137	Maltase A2 OS=Drosophila melanogaster OX=7227 GN=Mal-A2 PE=2 SV=2
P32818	1.98e-08	25	120	182	273	Maltogenic alpha-amylase OS=Bacillus acidopullulyticus OX=28030 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999936	0.000106	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003395_02876.