CAZyme Information: MGYG000003398.1_00038

Basic Information

• Species: HGM08974 sp900766555
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; HGM08974; HGM08974 sp900766555
• CAZyme ID: MGYG000003398.1_00038
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411		47531.5	9.8304

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003398.1	1111006	MAG	United States	North America

• Gene Location: Start: 4288; End: 5523 Strand: +

Full Sequence      

MNLFVSALEPSSNMHLLSLLRELDKNKNKNMPGIKISGIYSDFSNELKNLYFEPSLFHIS
DFSVMGFVDVLKRLSFFKNAQKLATKCALRSDLVLLLDGSSFHLRLAKDLKKHNFKKPII
YYILPQIWAWKPWRISQIMRDFTLLCAILPFELKNYESYISKMGLNKNDFIFDIKNFNAP
KKEHFSKDHFASVVYVGHPLFDSLKLQNEQKQKNKKTDKKLIFMPGSRIGEIKRIFPILR
DLAKDPALSGYKKILVIPTFFDKNNLDQIYGPTNDFELCFDTKKALDGAHFAFICSGTAT
LEAALLKVPFVLCYIAKNVDYLIAKNLLNIKFIGLANIMWSQFNDSFLHAELIQKDCNKQ
KLLSAFLDFDFDTFYKNVGFLRQYLGHGSAQNVSNILLQMYNQISQDKDRN

Enzyme Prediction     

EC	2.4.1.182

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	183	369	2.8e-42	0.5310734463276836
GT19	4	158	3.6e-37	0.4124293785310734

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14089	PRK14089	3.15e-139	1	400	2	347	lipid-A-disaccharide synthase.
COG0763	LpxB	4.68e-77	1	390	2	367	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.42e-67	3	365	1	334	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.05e-65	5	397	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK00025	lpxB	6.13e-54	1	403	2	377	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANV97464.1	1.23e-97	1	398	1	344
SQH71664.1	5.25e-88	1	397	1	351
CBG40162.1	5.25e-88	1	397	1	351
CAE09911.1	9.50e-84	1	400	1	347
VEG82125.1	9.50e-84	1	400	1	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.88e-16	89	367	89	342	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.88e-16	89	367	89	342	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B5Z7M7	1.66e-77	3	402	4	358	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain G27) OX=563041 GN=lpxB PE=3 SV=1
Q1CT05	1.85e-76	3	402	4	358	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain HPAG1) OX=357544 GN=lpxB PE=3 SV=1
Q17WJ2	2.62e-76	3	402	4	358	Lipid-A-disaccharide synthase OS=Helicobacter acinonychis (strain Sheeba) OX=382638 GN=lpxB PE=3 SV=1
B2USW3	1.15e-74	3	395	4	351	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain Shi470) OX=512562 GN=lpxB PE=3 SV=1
O25537	1.15e-74	3	402	4	358	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003398.1_00038.