CAZyme Information: MGYG000003400_00517

Basic Information

• Species: Stenotrophomonas sp003028475
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas sp003028475
• CAZyme ID: MGYG000003400_00517
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
785	MGYG000003400_12|CGC1	85776.61	7.0229

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003400	4365701	MAG	United States	North America

• Gene Location: Start: 16783; End: 19140 Strand: +

Full Sequence      

MLKPSRARMRSAVLLGSLLALLPALPALAADPTPAAEAPGPQLRAGSLMLIPAPATVQHG
QGRGITVRADTMLQAEGEAAQRVAAQFADLLARSGGPRLALAKGRTAAKSGSIHFQIVPT
FRDSGESYTLESTAQGVLIQAGNETGLFYGATTLAQLATGGSNGVLPAVQIQDAPRFSWR
GFMLDSARHFQSLDEIKRVLDAMAAHKLNTFHWHLTDDQGWRMEIKRYPKLTGVGSCRLP
AGDGGIDPVSGQEHPYCGFYTQEQIREVIAYAARLHIQVIPEIDVPGHATAAIAAYPELG
TIDTPLKPISEWGVFPNLFNTEDSTITFLENVLEEVIDLFPAKYVHVGGDEAVKDQWEAS
KPVQQRMRALGINNEMAMQSHIIKRLETFLEQHDRRLIGWDEILEGGLPPQATVMSWQGT
EGGLAAASAGHDVIMSPVGYLYLDYLQTASPNEPPGRPTQVNLGKLYNFEPVPAELAADK
RGHILGLQANMFTEHTRSYARLQHNLFPRLAAVAETGWSTPEHRDFRDFLARLPSQLQRY
RAWGLAYAQTPFEVGVDYTDKRAANTVTVSLANPLGYEVRYSTDGQPVSAQSPLYQQPLT
ATLPATVKAAAFYQGQMLAAKPTVAAFTAQSLLSRRSDELLSCVGKKGLVLRLEDDGPRE
GERAVFNVDIFQPCWRWPQAQLDGIGSVEVRAGRIPYYFQLAHDESKRRFEKAKRAHGEM
QVRRGDCRGKVLAEVALPAKPDADGFVTLRAALPKGTKGNGDLCINFTGDTRPAMWVLDE
VTLGK

Enzyme Prediction     

EC	3.2.1.52

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	172	520	1.3e-117	0.973293768545994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06563	GH20_chitobiase-like	0.0	177	533	1	357	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	8.79e-161	177	519	1	344	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	7.77e-159	32	643	118	732	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06570	GH20_chitobiase-like_1	1.28e-108	177	533	1	311	A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd06562	GH20_HexA_HexB-like	4.76e-88	177	541	1	343	Beta-N-acetylhexosaminidases catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides. The hexA and hexB genes encode the alpha- and beta-subunits of the two major beta-N-acetylhexosaminidase isoenzymes, N-acetyl-beta-D-hexosaminidase A (HexA) and beta-N-acetylhexosaminidase B (HexB). Both the alpha and the beta catalytic subunits have a TIM-barrel fold and belong to the glycosyl hydrolase family 20 (GH20). The HexA enzyme is a heterodimer containing one alpha and one beta subunit while the HexB enzyme is a homodimer containing two beta-subunits. Hexosaminidase mutations cause an inability to properly hydrolyze certain sphingolipids which accumulate in lysosomes within the brain, resulting in the lipid storage disorders Tay-Sachs and Sandhoff. Mutations in the alpha subunit cause in a deficiency in the HexA enzyme and result in Tay-Sachs, mutations in the beta-subunit cause in a deficiency in both HexA and HexB enzymes and result in Sandhoff disease. In both disorders GM(2) gangliosides accumulate in lysosomes. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDY50763.1	0.0	1	785	1	785
SQG68963.1	0.0	1	785	1	785
QJC73311.1	0.0	1	785	1	785
ASE54417.1	0.0	1	785	1	785
QGL73344.1	0.0	1	785	1	785

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q63_A	3.25e-137	50	599	31	588	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
3RCN_A	1.97e-108	108	547	62	513	CrystalStructure of Beta-N-Acetylhexosaminidase from Arthrobacter aurescens [Paenarthrobacter aurescens TC1]
7CBN_A	4.71e-108	126	547	78	510	Crystalstructure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835],7CBO_A Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila in complex with GlcNAc [Akkermansia muciniphila ATCC BAA-835]
7DUP_A	6.13e-90	126	549	79	522	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_A Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
7DVB_A	3.27e-89	126	549	79	522	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_C Chain C, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_D Chain D, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49008	4.82e-119	126	599	111	585	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2
B2UQG6	3.55e-107	126	547	97	529	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1
P96155	1.54e-75	110	520	194	607	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
B2UP57	2.42e-58	116	538	50	467	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1
Q7WUL4	1.14e-55	50	551	6	481	Beta-N-acetylhexosaminidase OS=Cellulomonas fimi OX=1708 GN=hex20 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000442	0.998562	0.000265	0.000295	0.000226	0.000176

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003400_00517.