CAZyme Information: MGYG000003400_01800

Basic Information

• Species: Stenotrophomonas sp003028475
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas sp003028475
• CAZyme ID: MGYG000003400_01800
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
258	MGYG000003400_25|CGC3	27738.68	9.5929

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003400	4365701	MAG	United States	North America

• Gene Location: Start: 100272; End: 101048 Strand: +

Full Sequence      

MFPRPAAIALLLLSSLWPGLAAARTVYRCVQGNTVSLATAPEPGSRCTPKEIDDNAIQTP
NLWGNMGVFSGVLYEREQDGALVYSTRNLPGSRVFLKFTVATPPGEPAHEGLGKVGAPQL
AQHAKQFKAAAKATGVDDAWLRAIAHAESNFDALAVSSKGAQGVMQLMPETAQEFGVRDP
FSPQQSIDGGARYMRALLRRYNGDRPLAAAAYNAGIGAVTRYKGVPPYAETLAYVDKVMA
LYARYREAMGIRNEVPAR

Enzyme Prediction     

No EC number prediction in MGYG000003400_01800.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	139	246	4.4e-31	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	4.16e-44	139	243	2	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.99e-34	134	246	17	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	2.28e-34	134	242	15	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	1.48e-29	135	246	9	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.54e-26	135	224	9	104	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGM03787.1	6.57e-178	1	258	1	258
QGL99673.1	6.57e-178	1	258	1	258
QBL39364.1	1.88e-177	1	258	1	258
QDY47523.1	1.88e-177	1	258	1	258
QNG85839.1	7.67e-177	1	258	1	258

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	2.80e-12	131	250	457	597	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	2.86e-12	131	250	486	626	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
5MPQ_A	3.69e-12	131	250	424	560	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	3.70e-12	131	250	428	564	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	3.72e-12	131	250	434	570	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	5.42e-32	127	242	64	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	1.29e-23	122	244	1421	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.29e-23	122	244	1421	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
Q1QZB1	2.51e-11	119	253	286	430	Membrane-bound lytic murein transglycosylase F OS=Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) OX=290398 GN=mltF PE=3 SV=1
Q4KHS7	3.39e-11	112	217	270	389	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000224	0.999185	0.000147	0.000148	0.000133	0.000127

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003400_01800.