CAZyme Information: MGYG000003400_03229

Basic Information

• Species: Stenotrophomonas sp003028475
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas sp003028475
• CAZyme ID: MGYG000003400_03229
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
872	MGYG000003400_56|CGC2	97029.83	7.0936

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003400	4365701	MAG	United States	North America

• Gene Location: Start: 98216; End: 100834 Strand: -

Full Sequence      

MHRPSLVVRLLLLLIAASAFPALAAPLQAQWEFRMLPGDAQGAAHPGLQQWRGATVPGSV
HTDLLAHALIRDPYVGAPESELQWIGLADWEYRARFDVDAATLAKPNAELRFDGLDTYAE
VSLNGKPLLRADNAHRTWRAHVEGHLRAKGNELRIVFRSPIRTLLPGVQAMPHRIAGNYP
SPYGDEPKDAMVGNFARKPAYHFGWDWGPRYVTAGVWRGVDLQAWDAHRLNDVAVRTDAL
DARQAKLTVLLQVEQGSAAGSAVVNVDVRDPQGRSVAQVQRTVLLKPGQNSVELPVELAE
PKRWWPVGHGAQDRYTVQARLDGGADATLVREQRIGLRTVELRREEDGKGGQGFAFVING
VPVFAKGANVIPFDAFPARVDAARLRQVLVAARDANMNMLRNWGGGYYEDDAFFDIADEL
GLLVWQDFMFGGGMQPGYDPAFRASVVAEARDNVRRLRHHPSIVLWCGNNEEETAWKDWG
HGRDLKAADPAFAAKVWQGYVDLFGNDLRQVVGEEALGVPYWSSSPSNDLDEKANDSTRG
DKHYWQVWGNPALPVQAYLRETPRFMSEYGLQAWPSVATVDQIATRAEQRIDSPVIRAHQ
KFMAGEGNSRLLHYIELGYGTPKDFEDFVYLSQVMQADGIALAALHHRASRPYTMGSLYW
QLNDVWPGASWSSVDYFGRWKALHYAARRFFAPVTVAALRDEGRTRVRLLNDGAARDARW
RLRVMDMDGKVLRRREQAVSLAAAGVTSIGDFTDAELLAGADPKRTVAVFELLQDGKVSA
RQVVGFAEAKDQVLPRQKLKATLAIDGDHYRLRLQSAAYVRAAWIDFGALDVTLEDNLLD
LLPGETRDIAIRGPVDLTTLRDALKVKTLNDR

Enzyme Prediction     

No EC number prediction in MGYG000003400_03229.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	26	745	1.3e-110	0.6795212765957447

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.65e-122	26	849	14	782	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17786	Mannosidase_ig	9.32e-14	706	791	4	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam17753	Ig_mannosidase	9.50e-12	798	871	3	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	3.44e-11	229	338	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10150	PRK10150	5.57e-11	31	474	19	420	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWB78228.1	0.0	1	872	1	872
VEF38408.1	0.0	1	872	1	872
CCH12512.1	0.0	1	872	1	872
QNG86098.1	0.0	1	872	1	872
QGL84374.1	0.0	1	872	1	872

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	6.41e-307	24	869	5	850	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	6.64e-307	24	869	5	850	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	4.84e-306	24	869	3	848	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	5.01e-306	24	869	5	850	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	3.07e-173	27	854	11	819	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q29444	7.39e-117	6	871	1	877	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
Q95327	1.11e-114	54	871	42	877	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
Q8K2I4	1.60e-113	54	703	42	700	Beta-mannosidase OS=Mus musculus OX=10090 GN=Manba PE=1 SV=1
I2C092	1.33e-112	21	853	3	840	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
Q4FZV0	6.54e-112	54	703	42	700	Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=Manba PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000425	0.998819	0.000190	0.000210	0.000181	0.000161

TMHMM  Annotations     

start	end
5	27