CAZyme Information: MGYG000003400_03403

Basic Information

• Species: Stenotrophomonas sp003028475
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas sp003028475
• CAZyme ID: MGYG000003400_03403
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297	MGYG000003400_58|CGC1	31326.65	10.1948

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003400	4365701	MAG	United States	North America

• Gene Location: Start: 27158; End: 28051 Strand: -

Full Sequence      

MKGILGTTAIIIAALTAAPASAGTLFKCQGADGVTSYVSKRVAGARCSTISYSRDTRPAP
RPMLAAPKPVTATVASIERNPVAVAASAAAPAMAAPAPAASRGGRMVSGQVYSFMKDGVR
HYTSARPTQVANLGPVRTIRYSFMERCYACGVNPRVDFGTVRLNTTAFQSEITSAAREFG
VDEAVVRAIIHAESAYNPTALSRAGAQGLMQLMPPTAARFGVSDSYDAGQNIRGGVQYLA
WLLKRFNGDLTLAAAGYNAGEGAVDRHGGVPPYSETQYYVRRVGQLAERYRTALSHQ

Enzyme Prediction     

No EC number prediction in MGYG000003400_03403.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	184	290	3.3e-29	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	2.06e-45	183	283	1	106	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	3.97e-43	166	283	4	142	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	1.74e-40	168	283	4	140	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.32e-31	175	266	4	101	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	7.89e-30	172	264	1	99	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDL27527.1	1.76e-186	1	297	1	299
BBO51081.1	3.00e-186	1	297	1	304
ACF51065.1	3.00e-186	1	297	1	304
QGL75577.1	3.00e-186	1	297	1	304
ARZ73969.1	7.69e-186	1	297	1	301

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.53e-12	168	290	416	555	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.53e-12	168	290	420	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	1.54e-12	168	290	426	565	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.55e-12	168	290	430	569	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.55e-12	168	290	436	575	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	5.79e-35	118	283	17	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	1.57e-27	168	283	1422	1537	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.57e-27	168	283	1422	1537	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	1.71e-11	172	260	11	98	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
A8ZWR8	2.34e-11	168	264	286	388	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000278	0.999094	0.000175	0.000148	0.000139	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003400_03403.