CAZyme Information: MGYG000003401_01254

Basic Information

• Species: Staphylococcus capitis
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus capitis
• CAZyme ID: MGYG000003401_01254
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
271		30982.08	5.4028

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003401	2394594	MAG	United States	North America

• Gene Location: Start: 232737; End: 233552 Strand: -

Full Sequence      

MLKKVTYSIISFSMLATSLGMVNANAEESSKSQSTSEKGTMGYGYQQYLKKHPNQKSNAT
QNRSTFSTKSRSAVTNTGERVLDISEWQGNLTDAQVKKLKKNYDFIIIRGQYGSEYVDQC
LEHNSALLDKNNMKFGVYSYSMYENADDARYEARTLYNRAPKASFYINDYEQSSVTSGDE
NTATQAWANQMRQLAGNKKILFYSYENFMVNHVANAVSSYDGYWLASYQAEEPTREKVLW
QYTDSYYSPELDQNVDANYLDSNVDASWFTS

Enzyme Prediction     

No EC number prediction in MGYG000003401_01254.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	83	248	1e-31	0.9717514124293786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06523	GH25_PlyB-like	1.02e-66	80	260	1	177	PlyB is a bacteriophage endolysin that displays potent lytic activity toward Bacillus anthracis. PlyB has an N-terminal glycosyl hydrolase family 25 (GH25) catalytic domain and a C-terminal bacterial SH3-like domain, SH3b. Both domains are required for effective catalytic activity. Endolysins are produced by bacteriophages at the end of their life cycle and participate in lysing the bacterial cell in order to release the newly formed progeny. Endolysins (also referred to as endo-N-acetylmuramidases or peptidoglycan hydrolases) degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	9.40e-23	80	259	1	185	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	7.83e-17	83	251	2	180	Glycosyl hydrolases family 25.
cd06414	GH25_LytC-like	1.49e-15	80	259	2	189	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
COG3757	Acm	6.67e-13	83	259	67	252	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAW91819.1	3.05e-194	1	271	1	271
QOX61673.1	3.05e-194	1	271	1	271
ATN03687.1	3.05e-194	1	271	1	271
AKL93210.1	3.05e-194	1	271	1	271
QKH92028.1	1.19e-191	1	271	1	271

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HMC_A	7.12e-20	81	270	7	189	Endolysinfrom Bacillus anthracis [Bacillus anthracis]
2NW0_A	1.29e-16	81	270	3	184	ChainA, PlyB [Bacteriophage sp.],2NW0_B Chain B, PlyB [Bacteriophage sp.]
2WW5_A	9.13e-08	66	258	256	465	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	9.13e-08	66	258	256	465	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000339	0.998994	0.000185	0.000167	0.000154	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003401_01254.