CAZyme Information: MGYG000003402_00268

Basic Information

• Species: Paenibacillus lactis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus lactis
• CAZyme ID: MGYG000003402_00268
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
664		75995.91	5.8017

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003402	5924245	MAG	United States	North America

• Gene Location: Start: 4349; End: 6343 Strand: -

Full Sequence      

MSGFPRDCFDIVFTGDFEVHNFSLAGSWVPWYSLHKIFAGLIDAYRLTGIEQALEVVIRL
ADWAKKGTDRLTDEQFQRMLICEHGGMNDTMADLYRLTNNHAYLELAIRFCHRAILEPLA
RGVDELEGKHANTQIPKVIGAAKLYEITGDDFYRKAAEFFWKEVTRNRSYIIGGNSIFEH
FRAANQEKLGVETAETCNTYNMLKLTDHLFGWSQDAEYMDFYERALYNHILASQDPDTGM
KMYFVSTEPGHFKVYGTAEHSFWCCTGTGMENPARYTHEIYHATSNAIYVNLFIASKATF
DDHQVVIRQETEFPKQSRTRLIIEEAKAAHFKLRIRIPQWTAGAVTAVVNGSEIYADAEP
GYLNIERDWNAGDTIEVTLPMELRLYHAKDDAKKVGILYGPIVLAGALGTEAFPDSDIVD
NHTKLHQHPLIEVPILVSDEPDIRQWIKPVDGEALTFVTEPVGQPGNSRVRLIPFYALHH
QRYTIYWNLLTEEEFKNYENRERAERERLKAITVDVVHPYQQQSEVDHHMKSEQSRSGYS
VYAQCGYRDAIGSGYFSYQMAVLPDQPMLLQVTYFSREGAAHVDGRLMERDFEILIDDHV
IARQRLEGTQGEQLFNVSYEIPIHLTEGKRSVEVKFASANGKLAGGVYGVRMIDRVQMEK
FVTK

Enzyme Prediction     

No EC number prediction in MGYG000003402_00268.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	2	405	2.7e-162	0.7952286282306164

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.53e-170	13	405	103	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	6.91e-170	31	478	130	573	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	9.44e-14	427	487	23	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYR19191.1	0.0	1	661	102	763
QKS44802.1	0.0	1	655	102	758
QNF29693.1	4.67e-310	1	654	102	755
APH66456.1	1.35e-297	1	654	102	755
AEP88543.1	2.21e-296	1	654	102	755

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	5.87e-129	15	653	147	801	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	4.11e-125	15	653	147	801	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	5.11e-28	28	403	132	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.09e-26	35	403	139	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003402_00268.